≈☼ OzeanClub© Freizeitclub.NRW #FridaysForFuture | #NeustartKlima NRWandern Berndt Ebler | DPsy.DE | #PsychologistsForFuture Dipl.-Psych. & Psychologischer Psychotherapeut >> Praxis WIRkfaktor℗ Gesundheit & Naturschutz≈☼ OzeanClub©  Freizeitclub.NRW#FridaysForFuture | #NeustartKlima   NRWandern Berndt Ebler | DPsy.DE | #PsychologistsForFutureDipl.-Psych. & Psychologischer Psychotherapeut>> Praxis WIRkfaktor℗ Gesundheit & Naturschutz

Kostenloser Newsletter

>> NRW-Treffen & Reisen

Das sind gute Freizeit-Aussichten.

Der "Cookie"-Hinweis im Banner unten wurde im Interesse internationaler Verständlichkeit auf Englisch verfasst. Hier das Wesentliche auf Deutsch:

Wir verwenden Cookies für die optimale Bereitstellung dieser Website. Mit der Nutzung erklären Sie sich damit einverstanden, dass wir Cookies verwenden. Mehr Informationen: Datenschutzerklärung


Aus Datenschutzgründen verzichtet diese Website auf Social Media-Plugins wie zum Beispiel Facebook.

Zum Weiterempfehlen können Sie auf das kleine Kuvert am Fuß dieser Seite klicken und dann eine Nachricht senden.

seit / since 02.12.2013

NEU: Ships@Sea

Deutschlands Interaktive Kreuzfahrt-Galerie mit Berücksichtigung des Themas Nachhaltigkeit

Service des OzeanClub©






wohnortnah@ Düsseldorf






NEU: WhatsApp-Gruppe NRWhatsApp

... für den Freizeit-Appetit zwischendurch.


Fan von Eichstätt im @Naturpark Altmühltal


WIRkfaktor unterstützt das wertvolle Engagement von #FridaysForFuture


& den KLIMASTREIK 2019 #AlleFürsKlima

plus #GlobalDayOnClimateAction



Mitglied bei Spontacts


Mitglied bei Groops


Mitglied bei Instagram


Freizeitaktivitäten &


... wohnortnah@ !


... wohnortnah@raum für neues Wohlbefinden & echte Begegnung.


... aus einsam in Düsseldorf wird gemeinsam in NRW

und an der See.


... alleinsein ist die große Chance zum Neuanfang.


... der NRW-Experte für nachhaltige Erlebniswerte.


... auf Linie mit Deiner Lust auf Meer.





... Plattform für Naturfans





Zentral-Institut für ReisePsychologie


... verstehen & gestalten was glücklich macht




Praxis WIRkfaktor

Psychotherapie / Coaching


Telefon: 0175-5593359


Berndt Ebler, DPsy.DE


> Diplom-Psychologe

> Psychologischer Psychotherapeut


> Verhaltenstherapie VT

> Psychologische Psychotherapie & Coaching nach Wirkfaktoren

> interdisziplinäre & multiprofessionelle Kooperationspartner

> alle Kassen, privat / Kostenerstattung, Selbstzahler

> Fotograf & Reiseleiter

> Freizeitclub-Organisator

> Seminarveranstalter

> Autor, Blogger & Werbetexter / Freelance Copywriter for Unique Content plus SEO

> Metaphernsammlung

> Destinationsmarketing, z.B. OKZITANIEN (FRANCE)

> Erlebnismarketing

> Reiseregisseur

> Berater für Gemeinschafts-Aufbau / Community Building


Graf-Adolf-Straße 89

D-40210 Düsseldorf


":Die Stadt mit Meerluft zum Atmen und Leben" ©


"Heimathafen für Weltentdeckung" ©


NahRaumWohlbefinden ©

Eichstätt im Naturpark Altmühltal

Der Ozean ... unser Silberstreif am Horizont.

The Ocean ... our silver lining on the horizon.

Partner der Bewegung BIG JUMP /

Partner of the Movement BIG JUMP /

Partenaire du Mouvement BIG JUMP


*Der Europäische Flussbadetag

*European River Swimming Day

*Journée Européenne de la Baignade en Rivière et Lac

*Das Portal für Lebendige Flüsse

*The Portal for Living Rivers

*Le Portail des Rivières Vivantes



Rufen Sie einfach an unter

+49 175-5593359


oder nutzen Sie unser Kontaktfomular.

Berndt Ebler, DPsy.DE ... unverkäuflich ;-)


Premium-Partner≈☼-Kreuzfahrten mit dem OzeanClub©

Immobilien am Meer

Linie D

Arbeitsgemeinschaft historischer Nahverkehr Düsseldorf e.V.

De Lijn De Kusttram

Straßenbahnlinie entlang der belgischen Nordseeküste


"Die Linie mit dem schönsten Ziel"

Linienplan des≈☼-Zubringers Rheinbahn

Bald kommt die neue Wehrhahn-Linie

Mit dem ICE International nach Amsterdam

... und dann weiter nach Zandvoort aan Zee

Mit dem Intercity an die deutsche Nord- und Ostseeküste

Mit dem TGV nach Südfrankreich

Nachtzugreise nach "Bella Italia"

Reiseblog-Tagebuch "MEERBLOG" von Elke Weiler

Worauf Sie sich freuen können:

*Romantische Unterkünfte

*Logenplätze mit Horizont

*Escapes & Hideaways


*Baden vor dem Haus

*Domizile mit Charme

*Refugien des Glücks

*Urlaub mit Meerblick


*direkte Strandlage


*Ruhe am Wasser

*Sonne & Seeluft


*begehrte Lagen





*Erholung pur



*Beachfront, Oceanfront, Coastline, Direct Access to the Beach, Sea View, Water Front, First Line to the Sea, First Sea Line

*Accès Direct à l'Eau, Bord de Mer, Face Mer, Les Pieds Dans l'Eau, Sur le Littoral, Sur la Plage, Vue Mer, en Première Ligne de Mer

*Acceso al Mar, a la Orilla del Mar, Frente Mar, Directamente en la Costa, sobre el Mar & en la Playa, Vista al Mar, en Primera Línea de Mar

*Accesso al Mare, Direttamente sulla Costa, sul Mare & sulla Spiaggia, Vista sul Mare, in Prima Linea sul Mare

*Wohnen mit Stil & Flair direkt am Meer

*Suchen & Finden

*Gesucht & Gefunden



*Bungalows und Chalets

*Overwater Bungalows


*Strandhütten / Strandschlafhütten / Strandhäuser / Strandschlafhäuser / Strandhäuschen / Strandschlafhäuschen = Strandhuisjes / Strandslaaphuisjes / Strandvakantiehuisjes (z.B. Domburg, Vlissingen, Groede & Katwijk aan Zee)

*Beach Huts


*Unterkunft für Selbstversorger






*Grand Hotels









*Bed & Breakfast

*Chambres d'hôtes

*Sobe / Rooms



*Boutique Hotels

*Beach Resorts

*Unterkunft für Flitterwochen / Honeymoon



*Toplage direkt am Meer

*Meerblick & Meerzugang


*Real Estate / Property in 1. Meereslinie

*Grundstücke in 1. Meereslinie

*Appartements / Penthouses / Wohnungen in 1. Meereslinie

*Anwesen / Häuser / Herrschaftssitze / Landgüter / Villen in 1. Meereslinie

*Exklusive Immobilien in bevorzugter, begehrter, exponierter, privilegierter Lage in 1. Meereslinie mit unverbaubarem Meerblick (z.B. Spanien / Balearen / Mallorca, Menorca, Ibiza, Formentera & Spanien / Alicante / Costa Blanca & Spanien / Katalonien / Costa Brava & Spanien / Andalusien / Costa del Sol, Costa de la Luz & Frankreich & Italien & Kroatien)

*Immobilien ohne Makler-Provision / Courtage anbieten, verkaufen & provisionsfrei kaufen

*Immobilienanzeigen online inserieren / schalten


*Zweitwohnsitze / Ferienimmobilien



*Erlebnis & Abenteuer

*Pulsierende Hafenstädte

*Bezaubernde Küstenorte

*Herrliche Landschaften

*Nationalparks am Meer

*Panorama-Berge & Meer

*Ocean & Mountain View

*EDEN European Destinations of ExcelleNce / Herausragende Europäische Reiseziele

*ökologisch verträglich, umweltbewusst & nachhaltig reisen

*Bahn- und Schiffsanreise

*vor Ort unterwegs mit Zug, Bus & Fähre


*Aktivurlaub am Meer




*Coastal Path

*Sentier Littoral

*Sentiero Litorale

*Festland & Inseln

*Natur & Kultur


*Kraftorte / -plätze

*Heilige Linien / Holy Lines

*Leylinien & Leypunkte

*magische & mystische Orte / Plätze

*Strände & Buchten

*Kino-Film-Drehorte am Meer / Coastline Movie Filming Locations

*Bahnlinien zum Meer

*Coastline Railways





*Kreuzfahrt-Reederei-Verzeichnis / Cruise Line Directory

*Windjammer / Segelschiffe



*Boote & Yachten





*Flussbadestellen / Outdoor Wild River Swimming Places / Lieux Baignade Sauvage Rivière / Luoghi Bagno Fiume

*Naturpools & Naturbäder / Natural Pools & Spas / Piscines Naturelles / Piscine Naturali / Piscinas Naturales / Piscinas Naturais

*Canyoning / Schluchting / Descente de Canyon / Torrentismo / Barranquismo

*Flussbaden / Flussschwimmen

*Wild Baden / Wild Schwimmen

*Skinny Dipping



*Garten- und Landschaftsbau "Galabau"

*Wellness, Spa / Sauna und Kur

*Meeresluft & Reizklima


*Single-Kreuzfahrten / Schiffsreisen / Seereisen

*Kreuzfahrten für Singles ohne Zuschlag


*Kurzurlaub und Wochenendtrips (z.B. Marseille & Norderney & Amsterdam-Zandvoort)




*Linie Aquavit

*Meersalz Salzblume / Fleur de Sel / Flor de Sal

*Fisch- und Meeresfrüchte-Restaurants / Seafood

*UNESCO-Weltkulturerbe Mittelmeer-Diät / Dieta Mediterranea (Ancel Keys, Cilento)



*Psychologisch-Philosophische Begleitung

*Therapeutische Reisen

*Seminare & Coaching



*Synchronizitaet Erfahrungen Forschung Phaenomen 47-1447 >> Kontakt

*Synchronicity Experiences Research Phenomenon 47-1447 >> Contact




*NRW-Aktion Singlefahrt

*Gruppenreisen ans Meer & Kreuzfahrten für Singles & Alleinreisende ab 20plus / Ü20 30plus / Ü30 40plus / Ü40 50plus / fifty-plus / Ü50 60plus / Ü60 / 66plus / Ü66 Jahren

*Seereisen & Flusskreuzfahrten

*Best Ager Seniorenreisen


*Reisepartner gesucht / Reisepartner finden


*Urlaubspartner gesucht / Urlaubspartner finden


*Wanderpartner gesucht / Wanderpartner finden

*Globetrotter gesucht / finden

*Freizeitpartner gesucht / finden

*Freizeitclub / Freizeittreff / Freizeitgruppe / Freizeitverein / Freizeitnetzwerk / Freizeitstammtisch

*Unser Freizeitclub ist fast kostenlos, kostenfrei, beitragsfrei, gebührenfrei (ohne monatliche oder jährliche Mitgliedsbeiträge / ohne Monatsbeitrag oder Jahresbeitrag; Aufnahmebeitrag 10€;  danach nur geringe Teilnahmegebühren je Veranstaltungsbesuch und somit maximale Flexibilität)

*neue nette Leute kennenlernen in Düsseldorf

*Tischgemeinschaft / paréa

*gemeinsam essen, miteinander essen, zusammen essen

*Niveauvolle und nette neue Leute aus der Region kennenlernen

*Seriöse Dating Events / beliebte Alternative zu Speed-Dating

*Nahraumerkundung / Umlanding

*Reiseclub / Reisetreff






*Meereskunde / Ozeanographie

*Meeresmuseum OZEANEUM

*ab NRW an die See

*Wunderbare Küstenlinien

*Ideale Ausflugsziele

*Zauber der Natur

*Kulturschätze entdecken

*Destinationen für Südensehnsucht

*Reiseziel-Schwerpunkte Atlantischer Ozean, Mittelmeer mit Adria und Ägäis, Dalmatien / Kroatien, Südfrankreich, Süditalien, Holland / Niederlande, Deutschland, Nordsee, Ostsee

*Spezialist für Marseille-Provence, Côte Bleue & Nationalpark Calanques, Riviera-Küste / Côte d'Azur, Languedoc-Roussillon mit Nîmes, Cevennen & Causses, Neapel-Kampanien mit Amalfiküste & Cilento / Costa Blu, Rom-Latium, Norderney, Sylt, Rügen, Split, Venedig & Verona sowie Zandvoort aan Zee / Blue Coast / Neuzeeland mit Nationalpark Zuid-Kennemerland & Amsterdam



... nur vom Feinsten.


... für Menschen, die auf die Linie ihrer Fantasie & Meeresbegeisterung achten.





Homepage erstellen

Kreuzfahrt-Reedereien und Kreuzfahrtschiffe der Welt

Aida Cruises: Aida Stella, Aida Mar, Aida Sol, Aida Blu, Aida Bella, Aida Luna, Aida Diva, Aida Vita, Aida Aura, Aida Cara Ambiente Kreuzfahrten: Azores American Cruise Lines: Independence, American Star, American Spirit, Amercian Glory Asuka Cruise: Asuka II Azamara Club Cruises: Azamara Quest, Azamara Journey Carnival Cruise Lines: Carnival Breeze, Carnival Magic, Carnival Dream, Carnival Splendor, Carnival Freedom, Carnival Liberty, Carnival Valor, Carnival Miracle, Carnival Glory, Carnival Conquest, Carnival Legend, Carnival Pride, Carnival Spirit, Carnival Victory, Carnival Triumph, Carnival Paradise, Carnival Elation, Carnival Sunshine, Carnival Inspiration, Carnival Imagination, Carnival Fascination, Carnival Sensation, Carnival Ecstasy, Carnival Fantasy Celebration Cruise Lines: Bahamas Celebration Celebrity Cruises: Celebrity Reflection, Celebrity Silhouette, Celebrity Eclipse, Celebrity Equinox, Celebrity Solstice, Celebrity Constellation, Celebrity Summit, Celebrity Infinity, Celebrity Xpedition, Celebrity Millennium, Celebrity Century Club Med Cruises: Club Med 2 Compagnie du Ponant: Compagnie du Ponant Le Soleal, Compagnie du Ponant L'Austral, Compagnie du Ponant Le Boréal, Compagnie du Ponant Le Ponant Costa Kreuzfahrten: Costa Fascinosa, Costa Favolosa, Costa Deliziosa, Costa Luminosa, Costa Pacifica, Costa Serena, Costa Magica, Costa Fortuna, Costa Mediterranea, Costa Atlantica, Costa Voyager, Costa Neo Riviera, Costa Victoria, Costa Neo Romantica, Costa Classica Croisières de France: Le Zénith, L'Horizon Cruise and Maritime Voyages: Cruise and Maritime Voyages Discovery, Cruise and Maritime Voyages Marco Polo Crystal Cruises: Crystal Serenity, Crystal Symphony Cunard Line: Queen Elizabeth, Queen Victoria, Queen Mary 2 Disney Cruise Line: Disney Fantasy, Disney Dream, Disney Wonder, Disney Magic Fred. Olsen Cruise Lines: Fred. Olsen Cruise Lines Braemar, Fred. Olsen Cruise Lines Balmoral, Fred. Olsen Cruise Lines Boudicca, Fred. Olsen Cruise Lines Black Watch FTI Cruises: FTI Berlin Hapag-Lloyd Kreuzfahrten: Europa 2, Europa, Columbus 2, Hanseatic, Bremen Hebridean Island Cruises: Hebridean Princess Holland America Line: Nieuw Amsterdam, Eurodam, Noordam, Westerdam, Osterdam, Zuiderdam, Amsterdam, Zaandam,  Volendam, Rotterdam, Veendam, Ryndam, Maasdam, Statendam, Prinsendam Hurtigruten: Fram, Midnatsol, Finnmarken, Trollfjord, Nordnorge, Polarlys, Nordkapp, Nordlys, Kong Harald, Richard With, Vesteralen, Lofoten Ibero Cruceros: Grand Celebration, Grand Holiday Island Cruises: Island Escape Kristina Cruises: Kristina Katarina Lindblad Expeditions / National Geographic: National Geographic Explorer, National Geographic Sea Lion, National Geographic Sea Bird, National Geographic Endeavour Louis Cruises: Louis Olympia, Louis Cristal, Louis Aura Mitsui O.S.K. Passenger Lines: Nippon Maru, Fuji Maru MSC Kreuzfahrten: MSC Preziosa, MSC Divina, MSC Magnifica, MSC Splendida, MSC Fantasia, MSC Poesia, MSC Orchestra, MSC Musica, MSC Opera, MSC Lirica, MSC Sinfonia, MSC Armonia Noble Caledonia Cruise Line: Caledonian Sky, Island Sky Norwegian Cruise Line: Norwegian Getaway, Norwegian Breakaway, Norwegian Epic, Norwegian Gem, Norwegian Jade, Norwegian Pearl, Norwegian Jewel, Pride of America, Norwegian Dawn, Norwegian Star, Norwegian Sun, Norwegian Sky, Norwegian Spirit Oceania Cruises: Riviera, Marina, Nautica, Regatta, Insignia Oceanwide Expeditions: Ortelius, Plancius Orion Expedition Cruises: Orion P&O Cruises: Azura, Ventura, Arcadia, Adonia, Aurora, Oceana, Oriana P&O Cruises Australia: Pacific Dawn, Pacific Jewel, Pacific Pearl Passat Kreuzfahrten: Delphin Paul Gauguin Cruises: Tere Moana, Paul Gauguin Phoenix Reisen: Amadea, Artania, Albatros Plantours Kreuzfahrten: Hamburg Princess Cruises: Regal Princess, Royal Princess, Ruby Princess, Emerald Princess, Crown Princess, Caribbean Princess, Diamond Princess, Sapphire Princess, Coral Princess, Island Princess, Star Princess, Golden Princess, Ocean Princess, Pacific Princess, Grand Princess, Sea Princess, Dawn Princess, Sun Princess Pullmantur Cruises: Zenith, Monarch, Empress, Sovereign Quark Expeditions Cruises: Fifty Years of Victory, Sea Spirit, Ocean Diamond, Clipper Adventurer Reederei Peter Deilmann: Deutschland ("Das Traumschiff") Regent Seven Seas Cruises: Seven Seas Voyager, Seven Seas Mainer, Seven Seas Navigator Royal Caribbean International: Allure of the Seas, Oasis of the Seas, Independence of the Seas, Liberty of the Seas, Freedom of the Seas, Jewel of the Seas, Mariner of the Seas, Serenade of the Seas, Navigator of the Seas, Brilliance of the Seas, Adventure of the Seas, Radiance of the Seas, Explorer of the Seas, Voyager of the Seas, Vision of the Seas, Enchantment of the Seas, Rhapsody of the Seas, Grandeur of the Seas, Splendour of the Seas, Legend of the Seas, Majesty of the Seas Saga Cruises: Saga Sapphire, Quest for Adventure Sea Cloud Cruises: Sea Cloud II, Sea Cloud Seabourn Cruise Line: Seabourn Quest, Seabourn Sojourn, Seabourn Odyssey, Seabourn Legend, Seabourn Spirit, Seabourn Pride SeaDream Yacht Club: Seadream II, Seadream I Silversea Cruises: Silver Spirit, Silver Whisper, Silver Shadow, Silver Wind, Silver Cloud, Silver Galapagos, Silver Explorer, Silver Discoverer Star Clippers Kreuzfahrten: Royal Clipper, Star Clipper, Star Flyer Star Cruises: Superstar Virgo, Superstar Aquarius, Star Pisces, Superstar Libra Swan Hellenic Discovery Cruises: Minerva Thomson Cruises: Thomson Majesty, Thomson Dream, Thomson Celebration, Thomson Spirit TransOcean Kreuzfahrten: Astor Travel Dynamics Cruises: Corinthian II, Yorktown TUI Cruises: Mein Schiff 3, Mein Schiff 2, Mein Schiff 1 Variety Cruises: Variety Voyager, Panorama II, Harmony V, Harmony G, Panorama, Pegasus, Galileo Venus Cruises: Pacific Venus Voyages of Discovery Cruises: Voyager Voyages to Antiquity Cruises: Aegean Odyssey Windstar Cruises: Wind Surf, Wind Spirit, Wind Star

Meere der Welt

Adriatisches Meer Ägäisches Meer/Ägäis Arabisches Meer Asowsches Meer Atlantischer Ozean Baffinbai/Baffin Bay Barentsee Beaufortsee Beringmeer Bottnischer Meerbusen Dardanellen Englischer Kanal Europäisches Nordmeer Finnischer Meerbusen Golf von Bengalen Golf von Biscaya Golf von Gaeta Golf von Genua Golf von Guinea Golf von Iskenderun Golf von Mexiko Golf von Neapel Golf von Salerno Golfe du Lion Große Australische Bucht Große Syrte Hudsonbai/Hudson Bay Humber Indischer Ozean Ionisches Meer Irische See Japanisches Meer Karasee Karibisches Meer Kaspisches Meer Kattegat Kleine Syrte Korallensee Laptewsee Ligurisches Meer Marmarameer Mittelmeer/Mediterranean Sea/Mer Méditerranée/Mare Mediterraneo Nordatlantischer Ozean Nordpazifischer Ozean Nordpolarmeer Nordsee Ochotskisches Meer Ostchinesisches Meer Ostsee Ostsibirische See Pazifischer Ozean Rade de Marseille Rhônedelta/Bouches du Rhône Rigaischer Meerbusen Rossmeer Rotes Meer Sargassosee Schwarzes Meer Skagerrak St.-Georgs-Kanal Straße von Dover Straße von Gibraltar Straße von Otranto Straße von Sizilien Südatlantischer Ozean Südchinesisches Meer Südpazifischer Ozean Südpolarmeer Tasmansee Tyrrhenisches Meer Vestfjord Weddellmeer Weißes Meer

world wide web



>> Das internationale Gruppen-Netzwerk für einen gesunden Planeten und die Gesellschaft von morgen


© / Sektor Deutschland / West / O-Zone alpha


Kontakt für Visionäre




>> The international group-network for a healthy planet and tomorrow's society


© / Sector Germany / West / O-Zone alpha


Contact for Visionaries




>> Le réseau international des groupes pour une planète saine et la société de demain


© / Secteur Allemagne / Ouest / O-Zone alpha


Contact pour Visionnaires




Psychologie-Luftlinie >> Impuls-Blog                                                                                     OzeanClub©

gegründet in meiner Studienzeit


Neue Horizonte und ein klarer Blick ganz nah

Diplom-Psychologe Berndt Ebler   |  DPsy.DE                                                                  1447 see you live!

Es hat begonnen und jetzt ...


Psychologie-Luftlinie Gedankenwelle Impuls Blog



Lieber Hüter des Planeten, als Gefangene der Wachstumslüge und Ausbeuter der Natur.

Lieber miteinander leben, als aneinander vorbei.



Kommentar zu Deutschland als einem der weltgrößten Rüstungsexporteure … und das mit wohlwollender Billigung einer Partei, die das "C" im Namen führt, was ursprünglich mal für "Christlich" stand:

Kennst Du das Land, in dem in Waffenschmieden die Kanoen glühn,

Profitorientierte Rohrkrepierer mit ihren scheinheiligen Argumeten das Gehirn verbrühn?


Es ist zu schaffen, dass der Wind sich dreht,

Brüder und Schwestern, es ist fürs Mündigsein noch noch nicht zu spät!


Die Rhetorik der Kapitalisten, sie war so hohl!


Das Land zu verändern, wollt Ihr es wohl?

Dahin! Dahin - möcht ich mit Euch, Ihr mutigen Mitstreiter wertbewusst ziehn.



Thomas Geisel SPD NRW gewinnt 2014 Stichwahl zum Düsseldorfer Oberbürgermeister gegen Dirk Elbers CDU

Am 15. Juni 2014 nutzen in Nordrhein-Westfalen die Bürgerinnen und Bürger der Landeshauptstadt Düsseldorf via Stichwahl ihre Chance um verkrustete Strukturen der Filz-Klüngel-Arroganz der Macht um Dirk Elbers (CDU) einen Denkzettel zu verpassen und frischen Wind in die Lokalpolitik zu bringen.

Die CDU ist im Irrtum, wenn sie meint, sie könnte sich auf der Illusion der "Alternativlosigkeit" ausruhen. Alternativlos ist nur die Möglichkeit und Notwendigkeit, sich vor dem Gang zur Wahlurne eine eigene Meinung zu bilden, um dann eine gute Entscheidung zu treffen.



Verrat an der deutschen Bevölkerung: Generalbundesanwalt verzichtet auf Ermittlungen in der NSA-Spähaffäre

In eklatanter Weise wurde unsere Privatsphäre durch Schnüffeleien der US-Geheimdienste verletzt. Kanzlerin Angela Merkel, deren Handy ebenfalls abgehört wurde, spielte in Anbiederung an den Zeitgeist-Jargon die Empörte ("Das geht gar nicht."), doch Konsequenzen blieben aus. Wirtschaftsinteressen wurden offensichtlich gegenüber unseren Freiheitsrechten als wichtiger eingestuft.

Nun will Generalbundesanwalt Harald Range auf Ermittlungen in der NSA-Spähaffäre verzichten, weil angeblich der Anfangsverdacht fehle, weil angeblich weder Zeugen noch belastende Dokumente zur Verfügung stünden. Diese Aussagen sind ein Schlag ins Gesicht aufgeklärter Bürgerinnen und Bürger, die wissen, dass nichts unternommen wurde, um den Hauptzeugen in dieser Angelegenheit - Edward Snowden - nach Deutschland zu holen, damit dieser vor dem NSA-Untersuchungsausschuss aussagen und seine Beweisdokumente vorlegen kann.

Mindestens grob fahrlässig wird dadurch die zweifellos notwendige Aufarbeitung einer tiefgreifenden Vertrauenskrise blockiert.

Nun drängt sich uns der folgende Verdacht auf: Hier wurde die Justiz in einer zum Himmel stinkenden Form der Rechtsbeugung unter politischen Druck gesetzt, um die Finger von einem heißen Eisen zu lassen, das die Profitpläne einer machtgierigen Clique aufs Spiel setzten könnte. Außerdem würde ans Tageslicht kommen, dass der deutsche und der US-amerikanische Geheimdienst auf skandalöse Art und Weise gemeinsame Sache machen und der freiheitlich-demokratischen Grundordnung Tag für Tag massiven Schaden zufügen.

Kommentare aus dem Lager der Opposition:

  • Bernd Riexinger, Chef der Partei Die Linke : "Damit würde amtlich festgestellt, dass die größte Grundrechtsverletzung in der Geschichte der Bundesrepublik juristisch unaufgearbeitet bleibt." Der Staat würde seine Schutzfunktion gegenüber den Bürgern "für eine Demonstration des außenpolitischen Duckmäusertums gegenüber der USA opfern", rügte er.
  • Christian Ströbele von der Partei Die Grünen, Mitglied im Parlamentarischen Kontrollgremium (PKgr) des Bundestages, nannte die Entscheidung von Generalbundesanwalt Harald Range im Deutschlandfunk-Interview "nicht nachvollziehbar" und führt weiter aus: "Jeder blamiert sich, so gut er kann. Diese Entscheidung ist völlig unverständlich ...". Es gebe genug Zeugen, die er in Ermittlungen befragen könne, etwa Journalisten und Edward Snowden selbst: "Der Generalbundes-anwalt macht sich damit lächerlich."  Range traue sich nicht, gegen die NSA vorzugehen, sagt Ströbele.

Kommentar in der Süddeutschen Zeitung vom 28.05.2014: "Kotau der Ermittler"

Aktualisierung vom 04.06.2014 >> Wahrscheinlich durch den massiven öffentlichen Druck (Meinungs- und Pressefreiheit & die Macht des Wortes zeigen ihre heilsame Wirkung !!!) hat sich Generalbundesanwalt Harald Range nun doch für Ermittlungen entschieden, allerdings nur im Hinblick auf das abgehörte Handy der Bundeskanzlerin Angela Merkel, nicht jedoch bezüglich der massenhaften Ausspähung deutscher Bürgerinnen und Bürger. Gemessen an dem Ausmaß der Verletzung unserer Privatsphäre ist dies zwar als Schritt in die richtige Richtung zu bewerten, bleibt allerdings freilich ein Lippenbekenntnis mit dem Potenzial zum Papiertiger. Es mutet schon wie Ironie an, dass sich die US-Administration um Barack Obama "verstimmt" zeigte angesichts des Ansinnens von Deutschland, die eigenen Freiheitsrechte zu verteidigen. Vor dem Hintergrund der unverschämten Schnüffeleien sind es doch wir, die aus gutem Grunde verstimmt sein können ... wenn nicht sogar empört!



Rechtsruck-Armutszeugnis der CDU um Angela Merkel im Wahlkampf 2014

Wenn Menschen nach der Macht streben, zeigen sie, wes Geistes Kind sie sind, zeigen sie oft ihr wahres Gesicht, selbst wenn sie es hinter dem Wort "Christlich" zu verbergen versuchen. So kommt es im wahrsten Sinne des Wortes zu einer Ent-Täuschung, zur Aufhebung einer Illusion, die bei genauem Hinsehen freilich auch schon vorher durchschaubar war.

Eine Studie der Europäischen Kommission hat ergeben, dass es die sogenannte Einwanderung in unser Sozialsystem so gut wie gar nicht gibt, dass Deutschland vom Zustrom der Migranten sogar profitiert. Unsere immer älter werdende Gesellschaft (Stichwort "Demografischer Wandel") ist sogar abhängig vom Zuzug von Menschen aus anderen Kulturen, die zu harter Arbeit bereit sind.

Der rechtspopulistische Ruck der CDU um Angela Merkel kurz vor der Europa-Wahl 2014 (siehe Artikel in der "Welt" über ihre Aussagen in der "Passauer Neuen Presse" am 22.05.2014) basiert anscheinend auf der Annahme, durch das Schüren von Ängsten, von ausländerfeindlichen Ressentiments und Vorurteilen könnte man an den Wahlurnen profitieren und nationalistische Schwachköpfe mit dem Horizont eines Suppentellers für sich gewinnen. Die dabei verwendeten Argumentationsfiguren sind vergleichbar mit der Behauptung, die Existenz von Thilo Sarrazin und ein paar verkauften Schmuddelbüchern ließe die Schlussfolgerung zu, dass ganz Deutschland rassistisch veranlagt sei.

Sozialleistungen werden - wenn überhaupt - meist nur im Sinne der Aufstockung in Anspruch genommen, wenn etwa ein profitgieriger, geldgeiler und geiziger Subunternehmer einer ausländischen Arbeitskraft statt dem tariflichen Lohn nur 2.85€ oder gar nichts zahlt ... und das kommt tatsächlich vor! (hier ein Beispiel)

Das jedoch thematisieren Angela Merkel und Konsorten nicht, da sie gerne einen Kuschelkurs mit den Kapitalisten pflegen. Deswegen werden wir auch vergeblich warten auf empörte Kritik aus ihrem Munde an den deutschen Waffenexporten, an dem Killer-Drohnen-Krieg des Geschäfts- und Handelspartners USA von deutschem Boden aus (gab es nicht in irgendeinem Buch den Aufruf "Du sollst nicht töten!" ?), an der Verletzung unserer Privatsphäre durch deren Geheimdienste, etc.

Dazu fehlt dieser Frau Format und mutiger Charakter, hierfür ist sie zu berechnend und auch zu beeinflussbar durch Lobbyisten. Sie ist eine Freundin der Macht und keine Freundin der Wahrheit. Anstatt Edward Snowden für seine wichtigen Enthüllungen zu loben und nach Deutschland einzuladen, erklärt sie ihn zur persona non grata ... eine Schande für unser Land ist das! Nur der Grünen-Bundestagsabgeordnete Hans-Christian Ströbele hatte die Zivilcourage, mit dem Whistleblower und Aufklärer Edward Snowden unter vier Augen zu reden.

Diese Anbiederung an spießbürgerliche Deutschtümelei ist hochnotpeinlich und deckt die zum Himmel stinkende, verfilzte schwarze Farce dieser Partei auf. Die Aussagen Angela Merkels mögen sich für sie und ihre Klüngel-Clique als Bumerang erweisen und den Mangel an Glaubwürdigkeit und zukunftstauglichen Ideen klar vor Augen führen!

Für diesen Faux-pas hat die CDU eine Ohrfeige verdient. Wir Wählerinnen und Wähler wissen glücklicherweise, wie das geht.

Diskutieren Sie dieses Thema in ihrer Familie, in ihrem Freundes- und Bekanntenkreis und nützen Sie die sozialen Netzwerke als Forum für Gedankenaustausch!



Der baldige Düsseldorfer Ex-Oberbürgermeister Dirk Elbers CDU wollte nicht tot über dem Zaun hängen

Wenn es der Kuh zu gut geht, tanzt sie auf dem Eis, besagt ein deutsches Sprichwort. Oft ist das Eis zu dünn für die Last der Überheblichkeit. Der zukünftige Düsseldorfer Ex-Oberbürgermeister Dirk Elbers (CDU) verstieg sich am 30.04.2014 mit Blick auf das Ruhrgebiet in beleidigender Unart zu der folgenden Aussage:

"Da will ich nicht mal tot über dem Zaun hängen!"

Diese Worte, die überraschenden Einblick in das Seelenleben eines anscheinend berechnenden, selbstverliebten Machtpolitikers gewährten, kamen offensichtlich aus dem Munde eines Menschen, der sich auf den Lorbeeren glücklicher Zufälle und Leistungen anderer Menschen ausruht - Stichwort "Schuldenfreiheit" - und sich in seiner behaglichen Komfortzone für unangreifbar hält ... welch tolldreister Irrtum! Der Schuss ging gründlich nach hinten los und die Popularität des sich selbst absägenden Volksvertreters sank rapide.

Wer sich die lohnende Mühe gemacht hat seinen eingeschränkten Horizont zu erweitern und das Ruhrgebiet jenseits oberflächlicher Beurteilung in seiner wahren Seelentiefe kennenzulernen, kann bestätigen, dass dort überaus herzliche Menschen leben, echte Vorbilder, die es auf bewundernswerte Art und Weise schaffen, den Strukturwandel kreativ zu gestalten, einen Strukturwandel, der aus Perspektive der CDU anscheinend aus dem Motto "Vom Kohleabbau zum Demokratieabbau" besteht. Nun ja, um Kohle geht es weiterhin ... fragt sich nur um wessen, was auch auf das Plakakt "Wohlbefinden Wirtschaft Wachstum" zutrifft ... hohle, fantasiearme Phrasen, die an Bauernfängerei grenzen.

Facebook-Aufruf zur Abwahl des Düsseldorfer Oberbürgermeisters Dirk Elbers (CDU) am 15.06.2014


Berndt Ebler, :DPsy :D211




OzeanClub Aufruf N°1  >HO'OPONOPONO ("PonoPono")

we we we ponopono de e  ;-)

Aktivismus ist Freiheit, Aktivismus ist Zukunft, Aktivismus ist sexy

Charles Veitch ("The Love Police") vs. Mc Donald's
Love Police Cologne / Köln
Art of Noise: Born on a Sunday Live
nur 3. Platz :-( im Waffenhandel
The Story of Stuff / Die Geschichte des Krempels
The Story of Change / Die Geschichte der Veränderung

OzeanClub Aufruf N°2  >Bei der Bundestagswahl 2013 alle Parteien boykottieren, die deutsche Waffenexporte fördern.

OzeanClub Aufruf N°3  >Auf täglichen Fleischkonsum verzichten, dadurch mehr genießen und längerfristig die Massentierhaltung überflüssig machen.

OzeanClub Aufruf N°4  >> Bei der Bundestagswahl 2013 alle Parteien boykottieren, die eine profitmaximierende Wirtschaftsweise fördern und somit eine ökologische und menschliche Katastrophe heraufbeschwören.

OzeanClub Aufruf N°5 >> Auf die schmutzige Produktpalette des Nestlé-Gesocks und seines gierigen Konzernchefs Peter Brabeck verzichten, der das Menschenrecht auf Trinkwasser ablehnt ( weiteres Zitat aus dem Film "We Feed The World", das tief blicken lässt: "... wie modern diese Fabriken sind, hochrobotisiert, fast keine Menschen!" [in geradezu verzücktem Tonfall] ) &  

OzeanClub Aufruf N°6  > Jetzt Petition gegen Privatisierung der Wasserversorgung unterzeichnen : Wasser und Sanitäre Grundversorgung sind ein Menschenrecht. Wasser ist ein Öffentliches Gut, keine Handelsware.

Oliver Welke und Gernot Hassknecht von der ZDF heute show ziehen vom Leder zum Thema "Privatisierung der Wasserversorgung"
The Story of Bottled Water / Die Geschichte des Wassers in Flaschen (mit Annie Leonard)
Bottled Life: Nestlés Geschäfte mit Wasser (arte Doku)
Schwarze Liste ethisch fragwürdiger Unternehmen wie Coca-Cola, Deutsche Bank, McDonald's, Monsanto, Nestlé, ...
The Case for ReWilding - A Love Police Special
Wortfront: "Es regnet"

Du kannst unsere Kampagne unterstützen, indem Du diese Aufrufe in Deinen sozialen Netzwerken verbreitest und davon erzählst. Du hast Einfluss!

Schwärme mit uns von und in der Macht des Schwarmes! 30 000 & DU x ... = ~~~

Roberta Barabino: "Febbraio" (Album "Magot") ... lasst uns ein Vorbild sein für die Kinder!
Port Royal: "Roliga Timmen" (Longing Machine)
Art of Noise: "Robinson Crusoe"

Spiegelsextant - Reflexionen und Impulse für die Lebensreise

Ich wünsche Euch allen ein Fest der Liebe, des tieferen Lichtes und des Friedens ohne Anfang und ohne Ende. Es wäre schön, wenn die Weihnachtszeit uns dabei hilft, dieses unbezahlbare Geschenk, das über jeden Kalender und jede Konfession erhaben ist, in unser Bewusstsein und von dort in die Welt zu lassen.

~*Des Liebenden Herz ist angefüllt mit einem Ozean. In seinen rollenden Wogen wiegt sanft sich das All. (Rumi)

~*Voneinander isolierte Systeme existieren nicht. Jedes Teilchen des Universums steht mit anderen Teilchen in direkter Verbindung, die schneller als Licht ist. Selbst wenn die Teile durch riesige Entfernungen voneinander getrennt sind, bildet das ganze System eine ungeteilte Einheit. (John Bell, Quantenphysiker) 

~*Komm! Komm wieder! Wer Du auch bist! Wenn Du auch Götzendiener oder Feueranbeter bist. Komm wieder! Dies ist die Tür der Hoffnung nicht der Hoffnungslosigkeit. Auch wenn Du Tausendmal Dein Versprechen gebrochen hast. Komm! Komm wieder! (Rumi)

~*Meine Herren, als Physiker, der sein ganzes Leben der nüchternen Wissenschaft, der Erforschung der Materie widmete, bin ich sicher von dem Verdacht frei, für einen Schwarmgeist gehalten zu werden. Und so sage ich nach meinen Erforschungen des Atoms dieses: Es gibt keine Materie an sich. Alle Materie entsteht und besteht nur durch eine Kraft, welche die Atomteilchen in Schwingung bringt und sie zum winzigsten Sonnensystem des Alls zusammenhält. Da es im ganzen Weltall aber weder eine intelligente Kraft noch eine ewige Kraft gibt - es ist der Menschheit nicht gelungen, das heißersehnte Perpetuum mobile zu erfinden - so müssen wir hinter dieser Kraft einen bewussten intelligenten Geist annehmen. Dieser Geist ist der Urgrund aller Materie. Nicht die sichtbare, aber vergängliche Materie ist das Reale, Wahre, Wirkliche - denn die Materie bestünde ohne den Geist überhaupt nicht - , sondern der unsichtbare, unsterbliche Geist ist das Wahre! Da es aber Geist an sich ebenfalls nicht geben kann, sondern jeder Geist einem Wesen zugehört, müssen wir zwingend Geistwesen annehmen. Da aber auch Geistwesen nicht aus sich selber sein können, sondern geschaffen werden müssen, so scheue ich mich nicht, diesen geheimnisvollen Schöpfer ebenso zu benennen, wie ihn alle Kulturvölker der Erde früherer Jahrtausende genannt haben: Gott! Damit kommt der Physiker, der sich mit der Materie zu befassen hat, vom Reiche des Stoffes in das Reich des Geistes. Und damit ist unsere Aufgabe zu Ende, und wir müssen unser Forschen weitergeben in die Hände der Philosophie. (Max Planck)

~*Seien Sie die Veränderung, die Sie in der Welt sehen wollen. (Mahatma Gandhi)

~*Alles im Universum befindet sich in Dir.  Frage und bitte Dich selbst um alles, was auch immer es sein mag. (Rumi)  

~*"Jesus sprach: Das Reich Gottes ist in Dir und um Dich herum, nicht in prachtvollen Gebäuden aus Holz und Stein. Spalte ein Stück Holz und ich bin da. Hebe einen Stein auf und Du wirst mich finden." (Thomas-Evangelium)


1a-Tages-WebSchatz ~~* (>> Bilder anklicken)

1a-Tages-WortSchatz ~~* >> Englisch: benevolence = Güte >> Deutsche Redewendung:  sich kein Blatt vor den Mund nehmen   =  sehr deutlich werden in seinen Worten, jemandem die Leviten lesen. Aus der Theatersprache, wo in der Antike in den Zeiten vor der Theatermaske ein Feigenblatt das Gesicht des Schauspielers verbarg, so dass dieser für seine Worte nicht zur Rechenschaft gezogen werden konnte.


Web-Installation "Lebensfilm Projektionstraum.Weißlichtprisma ^2012"

Joint Venture LuxInvictus SolAeterna unlimited


Geschenke von Charles Eisenstein

Charles Eisenstein, Jahrgang 67, graduierte an der renommierten Universität in Yale in Philosophie und Mathematik. Unbefriedigt von der kompetitiven Struktur der Wirtschafts- und Arbeitswelt arbeitete und lebte er lange Zeit als Dolmetscher in Taiwan. Persönliche, spirituelle und globale Krisensituationen führten ihn zu einer intensiven Beschäftigung mit der Body-Mind-Medizin. Heute präsentiert er seine Visionen als gefragter Vortragsredner, veranstaltet Seminare, verfasst Essays sowie Bücher zu neuen Wirtschafts- und Lebensformen.

<< Occupy Wall St - The Revolution is Love - A Short Film by Ian MacKenzie (mit deutschen Untertiteln)

"Love is the felt experience of connection to another being. An economist says 'more for you is less for me.' But the lover knows that more of you is more for me too. If you love somebody their happiness is your happiness. Their pain is your pain. Your sense of self expands to include other beings. This shift of consciousness is universal in everybody, 99% and 1%." ~ Charles Eisenstein

<< Kostenlose Internet-Version des Buches "Die Renaissance der Menschheit - Über die große Krise unserer Zivilisation und die Geburt eines neuen Zeitalters"

Vortrag von Charles Eisenstein zum Thema "Die Renaissance der Menschheit" (mit deutscher Übersetzung von Vivian Dittmar) >>

<< Kostenlose Internet-Version des Buches "Sacred Economics - Money, Gift & Society in the Age of Transition"

Sacred Economics with Charles Eisenstein - A Short Film by Ian MacKenzie (mit deutschen Untertiteln) >>

~~~ Ihr könnt diesen wegweisenden Autor unterstützen durch eine Spende, durch Teilen des Links in Euren sozialen Netzwerken oder durch Kauf des Buches "Die Renaissance der Menschheit" / "Ascent of Humanity" und / oder "Sacred Economics" ~~~


Flowetry by Phil Osophical

Phil Osophical shares Paradigm Shifting Flowetry and Back Like A Boomerang live @ the Shadow Lounge in "Peaceburgh", PA.




YouTube: CosmicRevolutionKS 


Bill Hicks: "It's Just A Ride"

<<   Bill Hicks: Die unvergessliche Metapher "It's Just A Ride" ("Die Welt ist wie eine Fahrt in einem Vergnügungspark ... ")

The World is like a ride in an amusement park, and when you choose to go on it you think it's real, because that's how powerful our minds are.  And the ride goes up and down and round and round, and it has thrills and chills and is very brightly colored, and it's very loud.  And it's fun, for a while.
Some people have been on the ride for a long time, and they've begun to question, 'Is this real, or is this just a ride?', and other people have remembered, and they've come back to us and they say 'Hey, don't worry.  Don't be afraid, ever, because this is just a ride.' and we KILL THOSE PEOPLE. 

"Shut him up!  We have alot invested in this ride! SHUT HIM UP!  Look at my furrows of worry.  Look at my big bank account, and my family.  This just has to be real."
It's just a ride.
But we always kill those good guys who try and tell us that.  You ever noticed that?  And let the demons run amok.  But it doesn't matter, because ... It's just a ride.
And we can change it anytime we want.  It's only a choice.  No effort, no work, no job, no savings of money.  A choice, right now, between fear and love.  The eyes of fear wants you to put bigger locks on your door, buy guns, close yourself off.  The eyes of love, instead see all of us as one.
Here's what we can do to change the world right now, to a better ride:
Take all that money we spent on weapons and defense each year and instead spend it feeding, clothing, and educating the poor of the world, which it would many times over, not one human being excluded, and WE CAN EXPLORE SPACE, TOGETHER, BOTH INNER AND OUTER, forever ... in peace.

 -- Bill Hicks (1961 - 1994)




Die Welt ist wie eine Fahrt in einem Vergnügungspark und wenn wir uns für diese Fahrt entscheiden, denken wir sie sei real, weil unser Verstand so stark ist. Und die Fahrt geht rauf und runter und rund herum, mit Nervenkitzel und Schauder, sehr hell gefärbt und sehr laut, und sie macht Spaß — für eine Weile.

Manche Leute machen diese Fahrt schon sehr lange und nach einer Weile stellen sie sich die Frage: Ist das echt, oder ist es nur eine Fahrt? Andere Leute haben sich erinnert und kommen zurück zu uns und sagen: „Hey, macht Euch keine Sorgen und habt keine Angst, denn es ist nur eine Fahrt” — und Wir …töten diese Leute…

„Bring ihn zum Schweigen! Wir haben in diese Fahrt viel investiert. Bring ihn zum Schweigen! Schau meine Sorgenfalten an… Schau mein großes Bankkonto an… und meine Familie… Das muss echt sein!”

Aber es ist nur eine Fahrt.

Aber wir töten immer die Guten die uns das versuchen zu sagen. Habt Ihr das schon mal bemerkt? Und wir lassen die Dämonen Amok laufen. Aber das spielt keine Rolle, weil es ist nur eine Fahrt — und wir können sie jederzeit ändern, wenn wir wollen.

Es ist lediglich eine Wahl.

Keine Mühe, keine Arbeit, kein Job, kleine Ersparnisse oder Geld — nur die Wahl — Jetzt Sofort — zwischen Angst und Liebe.

Die Augen der Angst wollen, dass Du größere Schlösser an Deine Tür anbringst, Waffen kaufst und Dich einschließt, die Augen der Liebe stattdessen sehen uns alle als Einheit

Hier ist etwas, das wir Jetzt tun können um die Welt in eine bessere Fahrt zu verwandeln: Wir nehmen all das Geld, das wir jedes Jahr für Waffen und Verteidigung ausgeben und stattdessen verwenden wir es um die Armen Leute auf dieser Welt zu ernähren, einzukleiden und richtig auszubilden, immer wieder und immer wieder, nicht ein Mensch ausgeschlossen und wir können den Weltraum erforschen…


Den inneren und äußeren…

Für immer…

In Frieden

-- Bill Hicks (1961 - 1994)



<< Bill Hicks: "It's Just A Ride" in Kinetischer Typografie (Olivier Ferland)

<< Erkennen, Handeln, Verändern

<< Charles Veitch & The Love Police: "Gospel of Bill Hicks"


Danny & Charlie: Die charmanten Megaphon-Aktivisten


Everything is OK: The Love Police

<< Eine Liebeserklärung an das Leben und die Redefreiheit 

Everything is OK: The Happy Carriage

<< Die innere Bereitschaft der Menschen zu unkäuflicher Freude und Freundlichkeit wird auf sympathische Art und Weise herausgekitzelt  (das britische Pendant zu unserer Initiative "Deutschland-Lächeln")

Everything is OK: Shopping-Hypnose

<< mit deutschen Untertiteln :-) 

<< Everything is OK "Corporate Property" ... Öffentliches Philosophieren über Sinn und Unsinn von "Privatbesitz"

<< Everything is OK "Operation Illusory Control" ... Inspirationen und Komplimente im Zentrum der Matrix des Konsumismus

<< Everything is OK "Danny Deconstructs the Mainstream Media" ... nachdenkliche Rede zum Thema Bangemachen und Verdummung zur besseren Kontrollierbarkeit der Bevölkerung

<< Everything is OK "Humanity's Playground" ... Experimente mit Spielräumen und Spielregeln der Gesellschaft

<< Everything is OK "On the Red Carpet" ... eine pfiffige Kommentierung des Glitzer- und Glamourzirkus rund um sogenannte "Stars", die vermeintlich interessanteren Menschen (die womöglich vor allem dazu da sind, uns vom Wesentlichen abzulenken ... à la Brot und Spiele ... Imperium kurz vor dem Kollaps)

<< Charles Veitch & The Love Police "Megaphoning the Drones" ... Aufklärungstrip mit einer Prise Selbstironie

<< Charles Veitch & The Love Police "Societal Control" ... Konventionen, Moral, Gesetze, Kontrolle, Gesellschaftsklima und die Entstehungsgeschichte von "Everything is OK"

<< Charles Veitch & The Love Police "The Shutdown of Love at Canary Wharf" ... Charlie erlebt an der Front der Shareholder-Interessen, an der Melkstation der Massen die brutale Seite der sogenannten "Security", der bemitleidenswerten Bodentruppe der globalisierten Kapitalismus-Großunternehmen

<< Charles Veitch & The Love Police "Hacking the London Matrix" ... eine Sammlung von Grundsatzreden, in denen gesellschaftliche Programmierungen sowie die unbewussten Gewohnheiten der dressierten Herde liebevoll aufgedeckt werden und an faszinierende Freiheitsmöglichkeiten erinnert wird

<< Charles Veitch & The Love Police "vs. Whole God-Awful System" ... "banks are too big too fail and you are too small to matter" ... unbequeme Tatsachen über Barclays und Konsorten (à la Deutsche Bank)

<< Charlie ist glücklich im schönen Köln, schwärmt von Deutschland und dem Wunder des Lebens

YouTube: Charles Veitch


Blimey Cow

Das Trio "Blimey Cow" nimmt geistreich und humorvoll fragwürdige Strömungen der Gesellschaft aufs Korn. Hier eine kleine Auswahl ...

Messy Mondays: Never Think Outside the Box

Messy Mondays: 25 Things You Say When You Don't Know What to Say

Deutsches Pendant: bla bla "Keine Ahnung" bla bla ;-)

Messy Mondays: Mindless Consumers

Messy Mondays: You Are Not an Activist

Messy Mondays: "Want" vs. "Need"

Messy Mondays: My Smartphone Made Me Stupid

Messy Mondays: "Like" vs. "Love"


Video SparkNotes

George Orwell's "1984" Summary ... "Big Brother Is Watching You!" ... eine traurige Vorschau auf Gehirnwäsche & Überwachungsstaat und zugleich ein Loblied auf Meinungsfreiheit & Rebellion

Aldous Huxley's "Brave New World" Summary ... Dystopisches Bild einer Gesellschaft, die regiert wird von Manipulation und Gleichschaltung der Massen, virtueller Realität, Konsum- und Profitorientierung, Verdummung und verordneter, oberflächlicher Fröhlichkeit auf der Basis von Psychoparmaka und Events ... was einzelne Menschen nicht daran hindern kann, dem Ruf der Freiheit und Ursprünglichkeit zu folgen


Elmar Altvater: Das Ende des Kapitalismus wie wir ihn kennen

Elmar Altvater (* 24. August 1938 in Kamen) ist ein deutscher Politikwissenschaftler, Autor und emeritierter Professor für Politikwissenschaft am Otto-Suhr-Institut der FU Berlin. Nachdem er zum 30. September 2004 emeritiert wurde, blieb er in Forschung und Lehre weiter am Institut aktiv. Des Weiteren ist er Mitglied im wissenschaftlichen Beirat von Attac und er war im Jahr 2006 Vorsitzender des Ständigen Volkstribunals gegen europäische transnationale Unternehmen. [Quelle: Wikipedia]

Vortrag "Das Ende des Kapitalismus wie wir ihn kennen" / Teil 1

Vortrag "Das Ende des Kapitalismus wie wir ihn kennen" / Teil 2

Vortrag "Das Ende des Kapitalismus wie wir ihn kennen" / Teil 3


Carl Sagan

Carl Edward Sagan (* 9. November 1934 in Brooklyn, New York City; † 20. Dezember 1996 in Seattle, Washington) war ein US-amerikanischer Astronom, Astrophysiker, Exobiologe, Fernsehmoderator, Sachbuchautor und Schriftsteller.

Carl Sagan, ein Sohn ukrainisch-jüdischer Einwanderer, besuchte die Rahway High School und studierte an der University of Chicago, promovierte 1960 bei Gerard Peter Kuiper. Carl Sagan bereitete den Weg für die Exobiologie sowie für die Suche nach außerirdischer Intelligenz (SETI). Er war Professor und Labordirektor an der Cornell University und hat zu den meisten unbemannten Weltraummissionen beigetragen, die unser Sonnensystem erforscht haben. Seine Idee war, eine friedliche Botschaft der Menschheit an einem Raumschiff anzubringen, die von einer außerirdischen Intelligenz verstanden werden könnte. Diese Botschaft realisierte er mit der goldenen Datenplatte Voyager Golden Record an den Raumsonden Voyager 1 und Voyager 2.

Er schrieb und moderierte die – mit Peabody Award und Emmy ausgezeichnete – dreizehnteilige Fernsehserie Unser Kosmos (Cosmos: A Personal Voyage; Deutsche Erstausstrahlung 14. Juni 1983), zu der es mehrere Neubearbeitungen mit verbesserten Computeranimationen gab, zuletzt 2005. Aus der Fernsehserie entstand das gleichnamige Buch, welches sich über 70 Wochen lang in der New-York-Times-Bestsellerliste hielt und damit das meistverkaufte englischsprachige (Wissenschafts-)Buch wurde. Darüber hinaus schrieb Sagan populärwissenschaftliche Bücher wie Die Drachen von Eden, für das er 1978 mit dem Pulitzer-Preis für Sachbücher ausgezeichnet wurde, und den Roman Contact, der 1997 mit Jodie Foster im Film Contact adaptiert wurde. Der Film endet mit den Worten „FOR CARL“ („Für Carl“).

Sagan war Gründungsmitglied des Committee for the Scientific Investigation of Claims of the Paranormal (CSICOP), Mitglied bei der Skeptics Society, Mitbegründer und erster Präsident der Planetary Society, Vorsitzender der „Division of Planetary Sciences“ der American Astronomical Society, Präsident der Abteilung für Planetologie der American Geophysical Union, Vorsitzender der Abteilung für Astronomie bei der American Association for the Advancement of Science und zwölf Jahre lang Herausgeber der Zeitschrift Icarus, eines Magazins für planetare Forschung. In den 1960ern war Carl Sagan Mitglied in einem Beratungsgremium der United States Air Force, das das Project Blue Book evaluierte.

Auf Sagan geht das Paradoxon der schwachen jungen Sonne und eine erste Deutung desselben zurück. Er wies dabei auf wesentliche Fragen des Klimas und Besonderheiten der Entstehung des Lebens auf der Erde hin. Sagan engagierte sich auch politisch, insbesondere zur Zeit des Vietnamkrieges wie später gegen die Strategic Defense Initiative Präsident Ronald Reagans. Sagan hielt mit Hinweis auf die Drake-Gleichung Leben außerhalb der Erde für durchaus möglich und erklärte das Fermi-Paradoxon mit einer Tendenz zur Selbstzerstörung technischer Zivilisationen.

Carl Sagan war dreimal verheiratet: 1957 mit der durch die Endosymbiontentheorie berühmt gewordenen Biologin Lynn Margulis (1938–2011, Mutter von Dorion Sagan), 1968 mit der Künstlerin Linda Salzman (* 1940, Mutter von Nicholas Sagan) und von 1981 bis zu seinem Tod mit Ann Druyan (* 1949), der Co-Autorin einiger seiner Bücher, der Fernsehserie Cosmos und des nach einer Vorlage von Sagan entstandenen Kinofilms Contact.

Nach langer Erkrankung an einer Myelodysplasie verstarb Carl Sagan im Alter von 62 Jahren. Das posthum veröffentlichte Buch Gott und der tropfende Wasserhahn (US-amerikanischer Titel: Billions and Billions) enthält einige seiner letzten Texte und endet mit einem Text seiner Frau, in dem sie den Menschen Sagan und seine letzten Tage auf sehr persönliche Weise schildert.

Isaac Asimov (1920–1992) sagte, dass er nur zwei Menschen getroffen habe, die er für klüger hielt als sich selbst. Carl Sagan sei einer dieser Menschen gewesen (der andere Marvin Minsky).

Die Landeeinheit der Mars Pathfinder Mission wurde 1997 zu Ehren von Carl Sagan in Carl Sagan Memorial Station umbenannt. Nach ihm ist auch der am 21. März 1982 von Edward L. G. Bowell entdeckte Asteroid (2709) Sagan benannt. Ihm zu Ehren wird der Carl Sagan Memorial Award vergeben. [Quelle: Wikipedia]

Cosmos Intro

The Pale Blue Dot

We Humans Are Capable of Greatness

Symphony of Science by "melodysheep" (YouTube): We Are All Connected (featuring Carl Sagan, Richard Feynman, Neil deGrasse Tyson, Bill Nye)


Der Film "Time for Change"

<< 2012, 2013 ... Willkommen im Zeitalter des Systemwandels durch bewusste Schwarmintelligenz, echte Demokratie und vernetzte Aktion!


“2012: Time for Change” presents an optimistic alternative to apocalyptic doom and gloom. Directed by Emmy Award nominee João Amorim, the film follows journalist Daniel Pinchbeck, author of the bestselling 2012: The Return of Quetzalcoatl, on a quest for a new paradigm that integrates the archaic wisdom of tribal cultures with the scientific method. As conscious agents of evolution, we can redesign post-industrial society on ecological principles to make a world that works for all. Rather than breakdown and barbarism, 2012 heralds the birth of a regenerative planetary culture where collaboration replaces competition, where exploration of psyche and spirit becomes the new cutting edge, replacing the sterile materialism that has pushed our world to the brink.


"2012: -Time for Change" zeigt eine optimistische Alternative zu apokalyptischen Weltuntergangsszenarien. Unter der Regie von João Amorim (bereits für einen Emmy Award nominiert) folgt der Film dem Journalisten Daniel Pinchbeck (Autor des Bestsellers "2012: Die Rückkehr der gefiederten Schlange") auf seiner Suche nach einem neuen Denken, das die archaische Weisheit alter Stammeskulturen mit modernen wissenschaftlichen Verfahrensweisen vereint. Die These: Als bewusst Handelnde der Evolution haben wir die Möglichkeit, die post-industrielle Gesellschaft nach ökologischen Maßstäben zu verändern und die Welt wieder für alle lebenswert zu machen. 2012 läutet nicht einen Zusammenbruch der Gesellschaft, sondern die Geburt einer globalen nachhaltigen Kultur ein. In dieser Kultur wird Zusammenhalt statt Wettbewerb als oberstes Prinzip gelten, und das Wertschätzen von Geist und Seele wird den nutzlosen Materialismus ablösen, der unsere Welt an den Rand des Abgrunds getrieben hat.


Mitwirkende >> Daniel Pinchbeck, Sting, David Lynch, Ellen Page, Paul Stamets, Gilberto Gil, Shiva Rea, Tiokasin Ghosthorse, Michael Dorsey, Ganga White, Barbara Marx Hubbard, Bernard Lietaer, Terence McKenna, Michael Coe, Curt Collier, Maude Barlow, Gaspar Pedro Gonzalez, Andre Soares & Lucy Legan, Nassim Haramein, Mitch Horowitz, Michael Jantzen, Ken Jordan, Kathi von Koerber, Joel Kovel, Dennis McKenna, Donald McPherson, Dean Radin, John Perry Barlow, Richard Register, Joe Rogan, Douglas Rushkoff, DJ Spooky, Penny Livingston-Stark, John Todd, Ryan Wartena, Craig Westcott, Inger Yancey, Maharishi Mahesh Yogi



<< Deutsche Version 


P-Blick - Faszination psychologischer Menschenkenntnis

SELBSTWERTKONZEPT >> "Selbstwertkonzepte beschreiben die Art und Weise, die Regeln und Bedingungen, nach denen jemand seine eigene Wertigkeit oder die von anderen bestimmt." (Stavemann, 2011)

>> Zum Hineinzoomen Bild anklicken

OrtZauber - Neue Anregungen für Phantasie und Urlaub (>> Bild anklicken)

Tafraoute / Anti-Atlas-Gebirge / Marokko

29°43'27.66"N 8°58'17.31"W

Mit gedrückter linker Maustaste kannst Du dann die gelbe "StreetView"-Figur zu einem der blau markierten Punkte oder einer Straße schweben lassen und die Gegend erkunden. Rechts oben kannst Du in der Ansicht von Google Maps zwischen Satellitenbild und Karte wechseln und auch Fotos aktivieren. Viel Spaß! 

Weitere ZauberOrtsMarken erwarten Dich bei den Registerkarten W.OrtZauber  (OzeanClub Fliblibuch) und OzeanVoyage Reisewelt 


*TraumKoordinaten* 21°11'20.12" >> entdecke einen der Paradiesorte unserer Welt

(nur für kurze Zeit öffentlich)


Deine EarthApp ... via Smartphone sogar jederzeit

Schenke Zahlen, die die Welt bedeuten können!


                                                                                                          Chillout Music >>

<< Reise-Video

Dein interaktiver Urlaubsplaner mit Reiseleitertipps aus erster Hand ... wertvolle Weichenstellungen für unvergessliche Erlebnistouren.

Die ZauberOrtsMarke mit ihrem Überraschungsinhalt öffnet sich durch Anklicken des Pin-Symbols. Durch Aktivieren der Überschrift navigierst Du in die Zielregion hinein.

Hier findest Du immer wieder neue Reise-Ideen und Inspirationen, die Du auch mit Deinem Freundeskreis teilen kannst. Viel Vergnügen beim WeltZoom FantasieFlug!

Mit gedrückter linker Maustaste kannst Du in Google Maps die gelbe "StreetView"-Figur zu einem der blau markierten Punkte oder einer Straße führen und durch die Gegend spazieren.

Weitere Anregungen zur Erkundung der Destination mit Google Maps und Google Earth (z.B. auch ein kleiner Kurs zur Steuerung des Flugzeuges) erwarten Dich im Pin-Text.

Google Earth Flugsimulator aktivieren >> 1. Zoom an Ort / Koordinaten ran. 2. "Tools" und "Enter Flight Simulator" anklicken. 3. Flugzeugtyp SR22 wählen und "Start Flight".

Je höher Du startest (durch Rauszoomen vor Aktivierung des Simulators), desto länger ist Dein Fluggenuss.

Während Dein Flugzeug nun eine Weile von selbst fliegt, kannst Du die Kamera schwenken, indem Du "Strg" und die Pfeiltasten drückst. So bekommst Du einen 3-dimensionalen Eindruck von der Landschaft.

Wenn Du mit Google Earth einfach "zu Fuß" zu den TraumKoordinaten schweben möchtest, dann klick mit dauerhaft gedrückter Maustate auf den "+"-Knopf des Zoom-Reglers, bis Du gelandet bist ...

... und zum Horizont blickst. Mit "Strg" und den Pfeiltasten kannst Du Dich jetzt umschauen. Zum Rauszoomen dann den "-"-Knopf des Zoom-Reglers wählen.

Tutorium für den Google Earth Flugsimulator (Bild anklicken, um den Film zu sehen)

Nach und nach kannst Du so eine Sammlung von TraumKoordinaten anlegen (z.B. bei Google Earth "Add" anklicken und danach "Placemark"). Wenn dann der nächste Urlaub vor der Tür steht, ...

... wählst Du einfach eine Region ganz nach Deinem Geschmack aus, verbindest die ZauberOrtsMarken (z.B. mit einem Routenplaner von Google Maps / Earth oder ViaMichelin) ...

... und fertig ist der Entwurf für Deine nächste Traumreise.

Kennst auch Du einen besonders schönen Ort? Sende uns eine kurze Info (genaue Koordinaten sind perfekt, jedoch nicht unbedingt erforderlich, vor allem wenn es sich um eine Stadt, ein Dorf, ein Kulturdenkmal oder einen bezeichneten Naturraum handelt) und mach der Welt damit ein Geschenk! Vorname oder Nickname genügt. Ein herzliches Dankeschön an alle, die schon ihre Erlebnisschätze mit uns geteilt haben!

Bitte geben Sie den Code ein

Hinweis: Felder, die mit * bezeichnet sind, sind Pflichtfelder.


Happy Landings: World's Most Amazing Airstrips

"Zoom" (I. Banyai)

<< anklicken für Impression nach der Landung

^^ Bild anklicken für ZoomFlug

"Salty Approach" / North Captiva Island / Florida / USA

26°36'12.64"N 82°13'12.58"W




Baška Voda, Dalmatien, Kroatien (Fotograf: Berndt Ebler)



Badestelle im Languedoc / Südfrankreich (Produzent: Berndt Ebler)

... mehr davon bei Reise-Video-Galerie


Musik für Entspannung, Inspiration und Konzentration

The Note: "Kundani Trance" >>


... mehr davon bei OzeanCoaching



zu erreichen über die Registerkarte "OzeanClub Fliblibuch" oder direkt hier

***NEU: Fliblibuch ... das offene Welt-Buch mit persönlichem Gesicht zum Mitmachen und Kennenlernen von Menschen mit ähnlicher Wellenlänge.


***NEU: Wiederfinden-Forum ... nach einem Blick, einem Lächeln oder einem Gespräch mit sympathischen Menschen Verbindung aufnehmen - auch ohne Kontaktdaten

*** Sie möchten eine Person wiedersehen, auf deren Kleidung eine Internet-Adresse gedruckt war? Sie sind jetzt kurz davor, dieses Ziel zu erreichen.

zu erreichen über die Registerkarte "OzeanClub Wiederfinden-Forum ... für die 2. Begegnungs-Chance" oder direkt hier


***NEU: blickshirt shop ... clever-kreativ-spielerisch flirten und Freundeskreis erweitern mit Weiterleitungs-Adressen auf Eurem interaktiven outfit ... die optimale Ergänzung zum Wiederfinden-Forum

zu erreichen über die Registerkarte "OzeanClub blickshirt shop" oder direkt hier


***NEU: Wirkungsfeld Synergie-Forum ... das Kompetenz-Netzwerk für Leute mit Grips

zu erreichen über die Registerkarte "OzeanClub Wirkungsfeld Synergie-Forum" oder direkt hier


Begegnung und Inspiration für ein besseres Leben in Deutschland und der Welt ... die tägliche Portion Bewusstein für helle Köpfe

Hallo! Ich freue mich, dass Sie den Weg hierher gefunden haben und wünschen Ihnen eine anregende Zeit

Sie können jetzt auf dieser Startseite hier weiterlesen oder ganz oben Registerkarten anklicken.

Der OzeanClub Deutschland und das online-Magazin Psychologie-Luftlinie sind entstanden durch Fusion von Begegnungskreis Trier, Euro-PassageVitalaVia, ViaVVentura, PhiloVentura, OrtZauber, ErkenntnisReisenLebenswertReisen, FliblibuchCortexClub Deutschland, metaphasebookAlphaWaveClub, Aktionspotentiale, DendritenbaumYouSeeLand, YouWeBook, webeyeap, webcampsy, webmeeteam, navigavia, blickshirt, Wiederfinden-Forum, WIRkungsfeld, WerteMarke & WeltenMarke, Deutschlandbund, Studibund Deutschland youniveau & younisono, Alumnibund Deutschland eurekapool, UniversitätsClub Deutschland / UniversityClub Germany (unicl), ErstiClub Deutschland unisextant, UniClubTrier sowie diverse andere werteorientierte Community-Projekte und Social Networks > unter einem Dach lebt sich's nun noch besser ;-)

Sie können sich diese Internetseite vorstellen wie einen großen, leicht erreichbaren Buchladen, in dem es zusätzlich nicht nur eine Musik- und Filmabteilung gibt, sondern auch noch einen diskreten Raum mit einem persönlichen Ansprechpartner für indivduelle Anliegen, ein Begegnungszentrum für kultivierte Menschen und ein Reisebüro.

Ziel dieses Forums ist es, die Vielfalt der Welt und des Lebens und einige der spannendsten Themen abzubilden und für Sie zugänglich zu machen ... dementsprechend reichhaltig ist das Angebot. Schließlich sollen Sie auch nach Ihrem 100. Besuch noch etwas Faszinierendes entdecken können. Nehmen Sie sich also bloß nicht vor, schon beim ersten Mal alles zu sehen!  ;-)

Eine so facettenreiche Auswahl kann zunächst vielleicht überfordernd wirken, wie eine vibrierende Großstadt oder eine unvertraute, exotische Kultur, in die Sie eintauchen, doch ist das gleichzeitig ein Garant gegen Langeweile und für die Lust am Erkunden neuer Orte.

Jetzt wollen Sie wahrscheinlich nur mal kurz reinschauen und sich einen Überblick verschaffen. Dafür können Sie ganz oben die Stichworte auf den Registerkarten überfliegen, vielleicht die eine oder andere anklicken und rausfinden, was sich dahinter verbirgt. So bekommen Sie einen Vorgeschmack auf Vertiefungsmöglichkeiten. Für den Anfang ist natürlich vor allem diese Startseite hier eine gute Adresse. Etwas weiter unten finden Sie eine ausführlichere Präsentation des Konzeptes.

Ganz oben auf der Startseite habe ich sozusagen einige Schaufenster eingerichtet oder - um im Bild des Buchladens zu bleiben - einen Tisch mit Beispielexemplaren aus der bunten Fülle des Sortiments. Aus den Bereichen Gedankensammlung, Filme und Musik hole ich im Abstand von wenigen Tagen interessante Beiträge hervor, lege sie dort aus und mache sie auf diese Art und Weise für Sie besonders leicht verfügbar. Für den kleinen Zwischenstop im Rhythmus des Alltags, für wohltuende mußevolle Pausen ist dieser Eingangsraum also besonders gut geeignet. Wenn Sie später mal Lust aufs Stöbern verspüren, werden Sie ein weites Betätigungsfeld finden.

Ich wünsche Ihnen, dass Sie sich durch die Ideenwelt dieser Seite in Ihrem Innersten angesprochen fühlen und nach jedem Besuch wieder ein bisschen klarer sehen, was Sie sich vom Leben wünschen und was Sie aktiv dafür tun können. Ich bin mir sicher, dass die hier berührten Themen auch einen prima Gesprächsstoff für Ihre ganze persönlichen Kontakte abgeben und würde mich freuen, wenn Psychologie-Luftlinie somit auch einen Beitrag zur Kommunikationskultur in unserem Land und ganz besonders in Ihrem persönlichen Umfeld leistet. Bestimmt haben auch Sie schon die Erfahrung gemacht, dass intensiver Gedankenaustausch jeden Tag noch lebenswerter macht.

Wenn Sie mich und andere Menschen mit Interesse an den hier im Fokus stehenden Themen kennenlernen möchten, so könnten Sie Gefallen finden an den Angeboten für Begegnung von Angesicht zu Angesicht. Die Ausflüge in Gedanken vor dem Bildschirm sind also nicht die Endstation, sondern können der Anfang einer abenteuerlichen Erkenntnisreise sein, zu der ich Sie herzlich einlade.

Bewahren Sie sich Ihre Aufgeschlossenheit, Ihr Fragen, Ihr Glauben an bessere Lösungen und Ihre Fähigkeit zum Staunen! So sind Sie hierher gekommen und so steht Ihnen die Welt offen.


Bis bald mal wieder!



Die Initiative OzeanClub & Psychologie-Luftlinie betreibe ich aus eigenen Mitteln, also ohne mich an "shareholder-Interessen" ;-) anpassen zu müssen und parallel zu meiner beruflichen Tätigkeit. Das ist mit viel Aufwand verbunden, doch das Projekt ist mir zur Herzensangelegenheit geworden. Für mich ist es eine Bereicherung, mich für etwas zu engagieren, das sich nicht direkt "rechnet" und immer mehr Menschen finden heraus, dass kaum etwas anderes so glücklich macht :-)

Wenn Du Dich für das Angebot finanziell erkenntlich zeigen willst, so wäre es vielleicht die beste Idee, wenn Du einer Hilfsorganisation wie z.B. "Brot für die Welt" oder "Aktion Deutschland Hilft" eine Spende zukommen lässt. Damit leistest Du einen Beitrag zu einer gesünderen Welt und bereitest auch mir eine Freude. Wenn Du zur Zeit jeden Cent umdrehen musst, dann sei einfach großzügig mit Zeit und Aufmerksamkeit und schenke Deinen Mitmenschen immer wieder ein Zeichen der Herzlichkeit. Es wird alles zu Dir zurück kommen. Vielen Dank im voraus!


Nächster Kennenlern-Abend in Trier

Sie wünschen Informationen über den nächsten Termin und den Treffpunkt? Es genügt, wenn Sie mir eine textfreie E-Mail mit dem Betreff "Kennenlern-Abend" schicken.

Alle sind dazu eingeladen, auch Vorschläge für
gemeinsame Freizeitaktivitäten mitzubringen.

Wie immer habe ich Impulse für eine spannende Diskussionsrunde dabei.

Wenn Sie Lust haben, können Sie sich im
Anschluss an die Veranstaltung mit anderen Teilnehmerinnen und Teilnehmern
zusammentun und den Abend in Trier gemütlich ausklingen lassen.

Wenn Sie noch Fragen haben, zögern Sie bitte
nicht, mit mir Kontakt aufzunehmen.

mehr dazu in der Rubrik "OzeanParty"


Kennenlern-Treffen und Seminare in Ihrer Region sowie Gruppenreisen in Europa

Per E-Mail halte ich Sie gerne auf dem Laufenden über aktuelle Aktivitäten in Gemeinschaft ganz in Ihrer Nähe und die nächsten Begegnungs-Reiseprojekte. Sie können sich auf eine umweltfreundliche Gruppen-Tour mit Gleichgesinnten nach Italien freuen. Die Reise ist noch in Planung, unverbindliche Voranmeldungen sind jederzeit möglich.


Großes OzeanClub "WIRkungsfeld" Deutschland-Treffen 2013

Nach dem Erfolg der Regional-Veranstaltungen und angesichts der erstaunlichen Resonanz auf psychologie-luftlinie (und das mit nur geringem Werbeaufwand!) ist es naheliegend, dass wir uns alle bei einem zentralen Event (der Anglizismus sei gestattet ;-) , sozusagen einem "Kongress des Bewusstseins" kennenlernen.

Wir werden uns an einem Ort treffen, der mit öffentlichen Verkehrsmitteln gut erreichbar ist. Wie Ihr mittlerweile herausgefunden habt, ist es meine große Neigung, Impulse zu geben ... das werde ich auch auf dieser Veranstaltung tun, in Form von Kurzvorträgen. Da wir uns live und in Farbe sehen, haben wir dann zusätzlich noch die Möglichkeit, einen faszinierenden und anregenden Gedankenaustausch zu genießen. Das wird sich voraussichtlich in einem dafür geeigneten Gruppenraum abspielen. Im Anschluss können wir noch mit der ganzen inspirierten und inspirierenden Truppe durch die Stadt ziehen und nach Lust und Laune feiern. In diesem Rahmen können dann bestimmte Themen unter vier Augen oder in Kleingruppengesprächen vertieft werden. Ihr könnt davon ausgehen, dass auch ich bis in die späten Abendstunden hochmotiviert sein werde, zu diskutieren und weitere Aktionen zu planen. Für Leute, die von weiter her aus unserem schönen Land anreisen, empfiehlt sich wohl eine Übernachtung.

Es ist völlig egal, welcher Nation, Religion oder Berufsgruppe Du angehörst. Bei uns wirst Du als ganze Person gesehen. Der Besucherzähler zeigt nur Nummern, doch dahinter stecken beseelte Menschen mit ihrer einzigartigen Lebensgeschichte, mit unverwechselbaren Gesichtern und Ideen. All diese Menschen scheint das Interesse zu vereinen, sich selbst noch besser zu verstehen, eigene Potentiale zur Entfaltung zu bringen, Träume zu verwirklichen, befriedigende Beziehungen aufzubauen und zu pflegen, Freude am eigenen Schaffen zu erleben und sich für Werte zu engagieren. Na, wenn das mal kein gemeinsamer Nenner ist! ;-)

Es ist für mich eine der schönsten denkbaren Aufgaben, diese Menschen ... Euch zusammenzubringen. Per E-Mail werde ich Euch über die aktuellen Planungen informieren. Wenn Du noch nicht im Verteiler bist: eine textfreie Mail mit Betreff "Verteiler" genügt.




Die Gedanken sind frei

aktuelle Anregungen von Berndt Ebler (mehr davon in der "Gedankensammlung")


Eine wichtige Quelle der Zufriedenheit sprudelt aus den Fortschritten, die wir in persönlich bedeutsamen Bereichen erzielen. Es kann sein, dass sich das Erfolgsniveau dabei stetig anhebt. Wir tun uns einen großen Gefallen, wenn wir unsere Erwartungen nicht unbegrenzt weiterwachsen lassen, sondern uns darin üben, uns an dem schon Erreichten zu erfreuen. Dazu trägt auch bei, wenn wir nicht nur die Entwicklung der jüngeren Vergangenheit in den Blick nehmen, wenn wir stattdessen auch daran denken, wo wir ursprünglich begonnen haben und was sich seitdem alles verändert hat. Mit einem gewissen Abstand verändert sich auch der Maßstab für die Bewertung unserer Errungenschaften. Wenn in einem bestimmten Zeitfenster zum Beispiel 100 zum Durchschnittswert geworden ist, verändert sich die Skalierung und ein Zuwachs von 20 erscheint vielleicht vernachlässigbar gering und ein Sinken auf 80 als Problem. Vergrößere ich die zeitliche Perspektive, fällt mir womöglich wieder auf, dass der Gesamtmittelwert bei 50 oder darunter liegt, verglichen damit die Erfolge der letzten Zeit alle sehr hoch angesiedelt sind und vorübergehende Einbrüche nichts an der positiven Tendenz verändern. Überblick und Dankbarkeit können Ruhe und Kraft schenken. (25.10.12).

Veränderung im eigenen Leben bedeutet immer auch ein bisschen Abschiednehmen von einem Teil seiner selbst. Wir setzen den Weg fort und halten die Erfahrung in Ehren. (27.10.12).

Was wäre die Welt ohne den warmen Puls unserer Kunstwerke und Geschenke? (27.10.12)

In dem, was uns am tiefsten bewegt im Leben liegt gleichzeitig leider auch ein Risiko, nur halb oder weniger verstanden zu werden. Am wichtigsten ist, dass wir uns mit diesen Erfahrungen selbst annehmen und ihren Wirkungen Raum geben. Dann können wir gelassener bleiben im Versuch, unsere Empfindungen und Gedanken mitzuteilen. (27.10.12)

Wenn wir uns über einen längeren Zeitraum hinweg in eine faszinierende Materie vertiefen, werden wir bestimmt viel erleben und entdecken, laufen aber auch Gefahr, andere wichtige Bereiche aus dem Auge zu verlieren, ja womöglich sogar, uns im Detail zu verlieren. Natürlich braucht es eine Weile, um herauszufinden, ob es nicht gerade das Abdriften vom ursprünglich geplanten Weg war, das unserem Leben eine wichtige neue Richtung gegeben hat. Das Risiko der Weltflucht, des Eskapismus, der Entfremdung vom Bisherigen bleibt jedoch. Ein bisschen kann man das vielleicht vergleichen mit einer Reise, auf der wir so intensiv in die neue Kultur eintauchen, dass wir das Gewohnte fundamental in Frage stellen, das Schiff, den Zug oder den Flug nach Hause verpassen und schließlich Probleme damit bekommen, uns wieder in den Alltag zu integrieren. Es ist ein schmaler Grat zwischen Reiz und Verhängnis und in den seltensten Fällen ist Auswandern die Lösung. (28.10.12).

Wir haben mehr oder weniger ausgeprägt die wohl natürliche Neigung, Erlebnissen Begriffe zuzuordnen sowie Orten und menschlichen Eigenschaften Namen zu geben. Das macht die Welt übersichtlicher und erklärbarer, erleichtert teilweise auch die Kommunikation. Verwechseln wir allerdings die Begriffe mit Wirklichkeit, dann werden wir Opfer des Greifenwollens, des Kontrollstrebens. Bei aller Begeisterung fürs Benennen, Bewerten und Kategorisieren tun wir uns also selbst und unseren Mitmenschen einen großen Gefallen, wenn wir uns offen halten für die Wahrnehmung, für das Erspüren des unetikettierbaren Seins. (31.10.12).

Wer Erkenntnisse sucht, muss auch mit Belastungssymptomen und Obsessionsstress rechnen. Den neuen Weg gibt's nicht zum Nulltarif. Der innere Frieden stellt sich dann nach einer Phase geistiger Unruhe ein. Habe Mut und Vertrauen! (01.11.12)

Das Siegel obsoleter Konventionen abzulösen kann vorübergehend weh tun wie das Entfernen eines überflüssig gewordenen Pflasters. (01.11.12)

Wie engstirnig es wäre, depressive Symptome lediglich als auszumerzendes Übel zu betrachten, als lästige Störung des Gehirnstoffwechsels! Das fördert zwar den Umsatz der Pharmabranche, bringt uns Menschen auf dem Weg der Erkenntnis aber kaum weiter. Es hieße, den Rauch mit dem Feuer zu verwechseln. Oft genug ist Depression Begleiterscheinung des Wandels, der langsamen, zwiespältigen Ablösung vom Überholten hin zum Neuen, voll verwirrender Zeichen, schmerzhaft und wichtiger Teil von Entwicklung. Oft genug sind die Patienten nur sensible Sprachrohre für die tieferliegenden Beschwerden eines wurmstichig gewordenen Gesellschaftssystems, genauso, wie der Jugendliche, der zum Psychotherapeuten geschleppt wird, nicht selten Indikator für kranke Familienverhältnisse ist. (01.11.12)

Eine der nobelsten Aufgaben der Psychologie besteht in der Stimulation der persönlichen Evolution, der Individuation, der Einswerdung eines Menschen mit seinem höheren Selbst und dem Weltgeist. C.G. Jung, Carl Rogers und Carl Sagan, um nur Beispiele zu nennen, wurden hierfür wertvolle Wegweiser. Wir danken Euch und allen anderen, die im Hintergrund wirken, ohne je berühmt zu werden und dabei doch genauso die Welt zu einem besseren Ort machen. (01.11.12)

So singen wir das Lied der aufsteigenden Herzwindblätter. (01.11.12)

Wenn Menschen sich auf eine Rolle reduzieren lassen oder sich selbst lediglich als Erfüller von Pflichten, als Vertreter von Interessengruppen sehen, zum Beispiel als Soldat, Lobbyist oder Manager, anstatt sich in erster Linie als Mensch, als Erdenbürger mit Teilhabe an Verantwortung für das Wohl des Planeten zu verstehen, dann geschehen viel zu oft Dummheiten, leider manchmal auch Verbrechen an der Humanität. (02.11.12).

Wir können Sucht, auch in ihren alltäglicheren, harmloseren Varianten, nur dann verstehen, wenn wir erkennen, dass darin auch Flucht vor etwas, das Sehnen und die Suche nach Erfüllung, nach etwas Absolutem, in gewisser Weise nach dem Heiligen Gral, nach einem Urprinzip, nach Anfang und Ende und ihrer Vereinbarkeit, nach Erlösung enthalten ist. Wenn sich der Fokus dieser Suche von der Außenwelt, von den Gegenständen, Substanzen, Institutionen und Personen, von den Ideologien verschiebt auf die Natur, unser eigenes spirituelles Wesen in der Innenwelt und die zwischenmenschlichen Beziehungen, dann naht die Befreiung aus dem Suchtprozess. (03.11.12)

Kreatives Schaffen nährt sich aus mehreren, gleichberechtigten Quellen, vollzieht sich auf verschiedenen Ebenen. Zunächst brauchen wir Inspiration für die Vision von einem neuen Gebäude, das wir errichten wollen, für den großen Plan. Dann geht es darum, die Bausteine zu erschaffen und Werkzeuge zu besorgen, um sie nach und nach aufeinanderzuschichten in Richtung der gewünschten Form. Da dieses Schaffensstück aus vielen Akten besteht, brauchen wir einen langen Atem. Mindestens genauso wichtig wie die umfassende Vision und die konkrete Umsetzung ist also auch die Energie, die es uns ermöglicht, unsere Arbeit mit Begeisterung und Zuversicht fortzusetzen und dabei auch gesund zu bleiben, im bestmöglichen Einklang mit unserer Umwelt. (03.11.12).

Gesundheit bedeutet auch, mehr vom Guten zu tun und mehr vom Schädlichen zu unterlassen. Das eine vom anderen für sich persönlich unterscheiden zu lernen, das nennt man wohl Lebenserfahrung. (03.11.12)

Durch den hohen Grad an Informationsvernetzung in unserer heutigen Zeit bedeutet das Öffnen der Tür zu einem neuen Interessensraum mehr und mehr auch Betreten einer damit assoziierten Welt. Diese kann uns im positiven Sinne gefangen nehmen, birgt in sich jedoch auch das Risiko, uns die Sinne zu vernebeln, so dass wir uns in diesen Dimensionen beinahe unbegrenzter Kombinationsmöglichkeiten verlieren können. Mehr denn je brauchen wir also die Fähigkeit zu Offenheit und Abgrenzung gleichermaßen. (06.11.12)

Manchmal stelle ich mir die besorgte Frage, wo die Menschen, die früher Systeme wie den Nationalsozialismus aufgebaut, den Menschen als pseudo-heilsbringend verkauft und dann bis ins Verderben vorangetrieben haben, wo Personen mit dieser Veranlagung zu Selbstsucht und Verblendung heutzutage ihr Unwesen treiben. Vielleicht am ehesten dort, wo sie die Rhetorik des Krieges, der einzig richtigen Wahrheiten, der Überlegenheit, weltweiten Vormachtstellung und Auserwähltheit ins Arbeitsleben und die Politik tragen, wo sie andere Menschen für ihre Zwecke benutzen, sie als Zahlenwerte und Opportunitätsfaktoren auf zwei Beinen sehen, als letztendlich austauschbar und nur aus strategischen Überlegungen heraus persönlich angesprochen und emotional berührt. Wir sollten nie vergessen, dass die gefährlichsten Agenten dieser Regime Leute in Anzügen und edlen Uniformen waren, unterwegs in glänzenden Automobilen. Es waren nicht die prügelnden Grobiane. Wenn wir aus unserer Geschichte lernen wollen, empfiehlt es sich also, weniger auf die Form und die beeindruckende Oberfläche zu achten und stattdessen mehr auf die bei näherer Betrachtung gespürte Intention. Diese lässt sich gut diagnostizieren, wenn man den Absichten clever zuwiderhandelt, wenn man Sand ins Getriebe streut und die glatt laufende Maschinerie auf gesunde Weise stört. (06.11.12)

Wir können in unserem Leben von Ort zu Ort eilen, Bilder und Namen sammeln, Fähnchen auf unserer biographischen Landkarte. Teil eines Ortes werden hingegen, durch Einfügen ins Beziehungsnetz, durch Mitprägen der lokalen Rituale, durchs Höherschlagenlassen unseres Herzens, das können wir nur in handverlesenen Koordinatenräumen. (10.11.12)

Sich aus dem Chaos neu entspinnende Harmonien ... Leben. (10.11.12)

Jeder Trip in Erfahrungswelten jenseits der Alltagsroutine ist eine Gratwanderung zwischen faszinierender Neulandentdeckung und Selbstverlust im Labyrinth der Illusionen. Nicht immer stoßen wir dabei auf eine Goldmine, doch mit großer Wahrscheinlichkeit haben wir schöne neue Landschaften gesehen, kulturelle Impulse gesammelt, die wir nun in unsere vertraute Welt integrieren, eine Welt, die wir nun im Idealfall auf hilfreiche Weise anders sehen können. (14.11.12)

Es hat etwas Tragisches, dass das, was uns krank oder zumindest hohl und voneinander entfremdet macht, exzessiver Konsum, Konkurrieren, Arbeitssucht, Selbstdefinition ausschließlich über Leistung etc. lange genug um ungesund zu werden von weiten Teilen der Gesellschaft verstärkt und bewundert wird. Ein korrigierbares Drama, durch Einsicht und Entschlossenheit und innere Autorität. (15.11.12)

Glück ist auch, sich für Projekte zu begeistern, ohne so weit von ihnen gefangengenommen zu sein, dass Scheuklappen entstehen, eine mangelnde Ansprechbarkeit für die Vielfalt des Lebens. Im Lot fühle ich mich, wenn bei aller Leidenschaft noch echte Aufmerksamkeit für meine Mitmenschen und meinen Körper vorhanden ist. (15.11.12).

Wie können wir die Wertschätzung für unsere Partnerschaft und für unsere Familie immer wieder erneuern? Ein Weg kann darin bestehen, dass wir uns vor Augen führen, dass wir es hier mit etwas Lebendigem, Unkäuflichen zu tun haben, was uns letztendlich als Geschenk zuteil wird, worauf wir keinerlei Ansprüche haben. Wir mögen uns dann selbst daran erinnern, dass die Partnerschaft in eine Krise geraten und zerbrechen könnte, dass dabei vielleicht Gründe ins Feld geführt werden, die etwas mit unseren momentanen Verhaltensmustern zu tun haben, Mustern, an denen wir hier und jetzt etwas verändern können. Ergreifen wir also rechtzeitig die Chance! Die bei aller Freude, Schönheit und Sinnhaftigkeit unausweichlichen Mühen und Ärgernisse des Familienlebens lassen sich womöglich dann eher mit Entschlossenheit und einem Lächeln der Akzeptanz annehmen, wenn wir uns immer wieder ins Bewusstsein heben, dass so eine Familie letzendlich eine großartige Geschichte ist, an der wir mitschreiben, eine Unternehmung, die Biographien schafft, die Lebensraum für Werte öffnet. (17.11.12)

Selbst wenn wir uns nichts Gravierendes haben zuschulden kommen lassen, kann allein der Tonfall einer uns entgegengeschleuderten Kritik die Illusion von Abwertung erzeugen, vielleicht weil wir durch dieses Szenario an Abstrafungs- und Einschüchterungsepisoden der Vergangenheit erinnert werden. Der erste Reflex kann dann in Richtung Flucht, Unterwerfung oder Erstarrung gehen. Sobald uns dies bewusst wird, können wir innerlich durchatmen, uns an unseren berechtigten Standpunkt erinnern und dafür sorgen, dass das Gespräch wieder auf Augenhöhe geführt wird. Ist unser Gegenüber nicht dazu bereit, werden wir Wege finden, den Kontakt zu beenden oder auf Sparflamme zu wechseln. (17.11.12)

Der heutige, oft übermäßig leistungsorientierte Alltag ist geprägt durch eine hohe Dichte an Bewertungssituationen und Vergleichsprozessen. Umso größer wird der Stellenwert einer klaren Selbstbejahung und ausreichender Unabhängigkeit von externer Beurteilung, dem "Like or Not" der Umwelt. (17.11.12)

Wenn wir uns in den Kopf setzen, möglichst viele Orte auf dieser Welt persönlich zu besuchen oder einen fulminanten Aufstieg auf der traditionellen Karriereleiter hinzulegen, wenn wir uns immer wieder mit anderen, vermeintlich Bessergestellten vergleichen, kann es sein, dass eine Verpassensangst in uns aufsteigt und das Leben plötzlich viel zu kurz erscheint für all diese ambitionierten Ziele. Je mehr wir uns auf die Basisfaszination des Seins besinnen, auf den Zauber des Hier und Jetzt, desto unabhängiger werden wir von Standort- und Statusfragen. Dann werden Berufspositionen und Reisedestinationen zu Verstärkern unserer Lebensfreude, sind allerdings nicht länger wesentliche Voraussetzung dafür. So können wir Unterwegssein und Arbeiten gelassener angehen, weil wir darin nicht mehr die Essenz unseres Glücks zu suchen brauchen. Dann achten wir mehr auf den Schmetterling, der sich auf uns niederlässt und fordern nicht, dass es an einem Karibikstrand geschehe. Dann achten wir mehr auf die Arbeitsqualitäten, die wir jetzt schon entfalten, sind dankbar für das Erreichte und die aufgebauten zwischenmenschlichen Beziehungen und treiben uns nicht voller Unrast zu neuen Höchstleistungen an. (18.11.12)

Wenn Du erreichen möchtest, dass Menschen auf etwas aufmerksam werden oder sich etwas merken, dann formuliere es pfiffig und prägnant und präsentiere es vor einem komplexen Hintergrund. Da die Komplexität die meisten Menschen überfordert, werden sie sich das Einfache umso lieber merken. Es wird zum Anker im Gedächtnis. (21.11.12)

Mehr und mehr bin ich davon überzeugt, dass "Heilung" nicht nur Symptombeseitigung bedeutet, sondern auch auf Umwegen geschehen kann und zwar dergestalt, dass unbewusste Kräfte Konfliktsituationen inszenieren, durch die innerpsychische und zwischenmenschliche Grundthem sowie Denk- und Verhaltensmuster so weit auf die Spitze getrieben und gespiegelt werden, dass sie bewusst werden. Ist diese Phase erreicht, sind wir eher dazu in der Lage, eine klare, werteorientierte Entscheidung zu treffen, was bedeuten kann, dass wir uns zu Zielen und Idealen noch eindeutiger bekennen, was allerdings auch beinhalten kann, dass wir von bestimmten Vorstellungen, von bestimmten Aspekten des Selbst- und Weltbildes Abschied nehmen, bestimmte Phänomene des menschlichen Lebens zu akzeptieren lernen, ohne länger damit zu hadern oder uns selbst den Vorwurf der Überangepasstheit zu machen. Die Einsicht und Verwandlung durch Krisenprozesse hindurch kann sich anfühlen wie die Geburt eines neuen Selbst. (22.11.12)

Für unsere Genussfähigkeit im Hier und Jetzt ist kaum entscheidend, mit welchen Ausrüstungsgegenständen, mit wieviel Geld, welchem Status und welchem Titel in der Tasche wir eine Situation erleben. Es geht vielmehr um die Sensibilität, unser Wahrnehmungsvermögen und die Fantasie, die wir mitbringen. Wirklich eintauchen in den Augenblick können wir auch dann am besten, wenn wir dazu in der Lage sind, die aufmerksamkeitskonsumierenden Verbindungen zu Vergangenheit und spekulativer Zukunft für eine Weile zu lockern oder gar zu kappen, um uns ganz auf die Gegenwärtigkeit einzulassen. Dies wurde mir heute wieder klar, als ich mich am Weiher im Uni-Park an der Strahlenkraft der verdoppelten Sonne erfreute, ein paar Schritte weiter dann am Herbstlaub vor dem tiefblauen Himmel. Ich wunderte mich darüber, warum ich so selten Menschen sehe, die einfach mal innehalten, um der Schönheit wirklich die Ehre zu erweisen. Stattdessen knallen sich viele vor den Fernseher und lassen sich berieseln durch Zerrbilder von vermeintlicher Schönheit, deren innere Hohlheit auch durch noch so viele Make Up nicht verborgen werden kann, das ganze dann mit dem Etikett "Star" versehen ... Sterne mit kurzem Verfallsdatum zumeist. Schon kurios, wie viele Menschen sich der Illusion hingeben, das Glück könnte am Ende des Weges auf sie warten, wie sie diesen Weg dann entlanghetzen und nur die plattgetrampelten Kaugummitraumblasen ihrer Vorgänger und Vorgängerinnen entdecken, wie sie dabei versäumen, nach oben zu schauen, um nichts weniger als den bereits existierenden Himmel zu entdecken. Es ist mir sympathisch, dass die Magie des Lebens uns nicht mit grellen Farben und lauten Tönen anspringt, sondern uns ihre Einladungen zärtlich ins Ohr flüstert, uns mit ihrem Hauch sanft berührt. Wir nehmen sie leichter wahr, wenn wir die Räume der Künstlichkeit verlassen, wenn wir abdocken von den Kopfhörern der Zerstreuung. Nach einer kurzen Phase der Neuorientierung werden wir erstaunt sein über die Erfahrungsintensität, die uns in dieser wiederentdeckten Ursprünglichkeit erwartet, über die süße Freiheit vom rattengleichen Befolgen der Ladentischlockrufe mit ihren Glückverheißungslügen. Es lebe die unkopierbare Natur, die Macht des immer schon da gewesenen, des Unvergänglichen! (22.11.12)


Erlebnisorientierte, energiebasierte Spiritualität fördert
die Freiheit der Menschen und ermöglicht Annäherung, wo vorher die Illusion
schier unüberwindbarer Gräben ihr Unwesen trieb. Wenn wir "Gott" mit
all den menschgegebenen Namensvarianten, wenn wir "das Böse" in all
seinen grob vereinfachenden Feindbildformen nicht mehr als außerhalb, als
getrennt von uns betrachten, sondern als ein dynamisches Kräftefeld, das in
unterschiedlichen Spielarten in uns allen wirkt, dann entwickeln wir ein
klareres Bewusstsein unserer Glücksmöglichkeiten und Selbstgefährdungen. Dann
verringert sich das Risiko, dass wir unsere vermenschlichenden
Gottesvorstellungen auf irdische, allzu oft patriarchalische Autoritäts- und
Führungspersonen, von Männercliquen dominierte Herrschaftsapparate projizieren,
in der irrigen Hoffnung, durch starke Hand ins Heil geführt zu werden, eine
Hand, die in der Regel nur den Profit für sich und die eigene Seilschaft sucht,
die Geborgenheit nur zum Preis des Untertanentums bietet und die sich Unterwerfenden
für diese Zwecke missbraucht mit fragwürdigen Wahrheits- und
Erlösungsversprechen, drohend mit zu bekämpfenden Schreckensszenarien.
"Himmel und Hölle", "Teufel", "Ungläubige",
"Bolschewismus", "Terrorismus", "Achse des Bösen"
sind nur Beispiele dafür. Dann verringert sich auch das Risiko, in Verleugnung
der eigenen Schattenanteile die Dämonen auf selbstgerechte Weise in der
Außenwelt zu bekämpfen, anstatt vor der Haustür, im Flur und auch Wohnzimmer
des persönlichen Lebensgebäudes zu kehren. So vieles macht Sinn, wenn wir
hinter die Oberfläche der Begriffe schauen und mit Hilfe unserer Gefühle
erahnen, was dadurch vielleicht symbolisiert werden soll. Die religiösen Texte
wirken dann eher wie eine inspirierende Schatztruhe auszulegender Kunstwerke, durchwirkt
mit dem roten Faden der allumfassenden Liebe. Aus dem Paradies können wir uns
dann nur noch selbst verstoßen durch Vernachlässigung der Verbindung mit
unserer spirituellen Urquelle, dem Teilhaben am Gesamtorganismus der
Menschheit, der eingebettet ist in die Einheit allen Lebens auf diesem
Planeten, der wiederum in Beziehung steht mit allem Sein in diesem Kosmos. Auch
dieser Kosmos kann, wie eine Zelle im Körper, in weiteren Dimensionen
existieren, Dimensionen, die sich zumindest momentan noch unserer
Vorstellungskraft entziehen. Ein Echo dieser Unendlichkeit, dieser
Unabhängigkeit von Raum und Zeit würde sich dann auch in den sogenannten
"kleinsten" Phänomenen finden. Wir als Menschen haben die
faszinierende Chance, im dreidimensionalen Raum, vorübergehend der linearen
Zeit ausgesetzt, die Zeichen und Signale dieses Mysteriums staunend zur
Kenntnis zu nehmen und den großen Rest an Ungewissheit gelassen auszuhalten.
Hier berühren wir den Bereich des Glaubens, der mehr oder weniger durch
persönliche Erfahrungen angereichert werden kann. Ich wage eine Deutung der
Trias "Vater, Sohn und Heiliger Geist". "Vater" könnte dann
stehen für das Schöpfungszentrum, das womöglich in einer für uns nur schwer
wahrnehmbaren Dimension angesiedelt ist, verborgen existent, wie Infrarotlicht
für unsere bloßen Augen, wie bestimmte Frequenzbereiche von Tönen für unsere
Ohren. Früher war der Vater auch eine eher distanzierte und gleichzeitig
bewunderte Autoritätsperson, der man mit Ehrfurcht begegnete, an die schwer
ranzukommen war. Insofern würde die Namensgebung psychologisch Sinn machen.
Aufgeklärt wie wir sind, würden wir heute wahrscheinlich eher
"Vater-Mutter", "Mutter-Vater", "Eltern" oder
"Wurzelgrund" oder "Ursprungsort" oder "Energiezentrum
allen Seins" oder "Quintessenz" oder "Quelle" oder
ähnliches sagen, doch die Traditionen wirken nach und viele verbinden mit
"Gott" im ersten Assoziationsreflex wahrscheinlich immer noch einen
weißbärtigen König, vielleicht sogar einen Richter, als gäbe es davon nicht
schon in der Geschichte der Menschheit genug. Interessanterweise findet der
Begriff "Mutter" dort seinen Platz, wo leiblicher, sinnlicher Kontakt
eher möglich ist, wenn wir von "Mutter Erde" oder vielleicht auch
"Gaia" sprechen. Ein Säugling wäre ein erschreckender Vampir, würde
er seine eigene Mutter bis zum Tod aussaugen, sich grinsend an der
Selbstbezogenheit ergötzend. Der Säugling nimmt von seiner Mutter im gesunden
Naturzustand nur so viel, wie diese wieder reproduzieren kann. Die
geldprofitmaximierende, kapitalistische Wirtschaftsideologie hat das Verbrechen
begangen, dieses gierige Vampirtum, diese parasitäre Verbrauchen von Ressourcen
in ein glänzendes, täuschendes Gewand zu packen, in imponierende Uniformen,
lockend mit den Einflüsterungen, auch belohnt zu werden mit diesen
Statussymbolen, wenn man sich am selbstzerstörerischen Spiel beteiligt. Es ist
an der Zeit, zu durchschauen, dass die Kräfte unter dieser Oberfläche
langfristig alle ins Verderben führen und auch die vermeintliche Insel der
Glückseligkeit der Strippenzieher und Mitläufer wird früher oder später unter
der Welle der Immunreaktion unseres Planeten begraben. Uns wurde leider in
unserer gesellschaftlichen Sozialisiation als Normalität verkauft, was
letztendlich Krankheit ist. Wir haben nun die historische Chance, aufzuwachen,
zu erkennen, den Kurs zu ändern und uns dafür einzusetzen, dass die Menschheit
und die Menschlichkeit eine Zukunft hat, anstatt, abgelenkt durch die
Vergnügungsmusik einer bezahlten Blaskapelle unterzugehen wie die Titanic. Ich
möchte nun die Deutung einiger Schlüsselbegriffe fortsetzen. "Sohn" -
heute können wir genauso gut "Tochter" oder "Kinder" sagen
- steht stellvertretend für Lebewesen im Kosmos, wie zum Beispiel die Menschen,
als vorübergehend dreidimensionalen Abkömmlingen der Ursprungsenergie. Einige
der Kinder dieser göttlichen Energie spürten die Verbindung mit ihrem Ursprung
besonders intensiv und erzählten davon und tun es bestimmt auch heute noch,
vorausgesetzt, sie werden nicht sediert durch Psychopharmaka oder eingeschüchtert
durch den Spott der engstirnigen Materialisten. Wir nennen diese Menschen gerne
Prophetinnen und Propheten. Einige von ihnen haben wir durch Überlieferung
kennengelernt, einige durch persönlichen Kontakt, ohne je dieses Etikett zu
verwenden, weil wir indirekt dazu erzogen wurden, davon auszugehen, dass Wunder
meistens in der Vergangenheit passieren und in der Regel nicht dort, wo man
selber gerade ist. Nicht umsonst wurde Mystizismus von der katholischen Kirche
mit Argwohn beäugt, wahrscheinlich interpretiert als Gefährdung der eigenen,
dogmatischen Deutungshoheit. Je mehr wir uns von Egoismus und Materialismus
distanzieren, je mehr wir zu uns selbst und durch uns hindurch zurückfinden zur
Quelle, je mehr wir uns einer mediativen, liebevollen Lebensweise im Einklang
mit der Natur und unseren Mitmenschen zuwenden, desto mehr werden wir spüren,
dass wir ständig baden in einer nicht mehr persongebundenen prophetischen
Energie, die erzählt von dem was immer war und immer sein wird, auch jenseits der
Welt von Uhren und Zahlen und Konstruktionen. Vielleicht ist es dieser Kontakt
mit dem Einssein, der manchmal herbeigesehnt wird mit den Worten "Heiliger
Geist". (05.12.12)

Die prophetische Kraft von morgen wird an allen Orten gleichzeitig auf die Erde herniederregnen und ein Meer schaffen aus erwachenden Herzen, die sich hinaufschwingen in die Weite des geistigen Himmels. (10.12.12)

Mitmenschen können wir in ihrer Entwicklung am besten fördern, wenn wir ihnen zu ihren Fragen nicht vorgefertigte Antworten liefern, sondern ihnen aufmerksam zuhören, um Verstehen ihrer Erfahrungswelt bemüht, um ihnen dann hilfreiche Schlüsselbegriffe für ihre weitere Suche anzuvertrauen. (10.12.12)

Wird Gold genügend erhitzt, so schmilzt es. Wird unser Geist durch das Feuer der Inspiration und Erkenntnis zum Schmelzen gebracht, so kann er mit Bewusstsein füllen, wo vorher Hohlraum war. Dies ist das Kunstwerk seelischen Wachstums, an dem wir alle mitwirken. (10.12.12)

Heute wurde der höchste Datums-Joker in der Zeitrechnung der Menschheit erreicht. Die mittlere 12 ist der limitierende Faktor. Meines Erachtens steht dies auch symbolisch dafür, dass wir an die Grenze des Wachstums in der Welt der Zahlen und Materie gestoßen sind. Nun kann das Zeitalter des Reichtums in einem bislang vernachlässigten Bereich beginnen, dem der seelischen Reifung zur Weltgemeinschaft geistiger Wesen. Wir können zuversichtlich sein. Der Kosmos hält für uns noch Konstellationen bereit, die über die Dreieinigkeit der 12 weit hinausgehen. Auf uns wartet der Hauptgewinn, wenn wir bereit sind, uns für seinen Zauber zu öffnen. (12.12.12)

Durch schwere Zeiten, durch die Dunkelheit in Nachtzeiten unseres Lebens kann das Kerzenlicht der Spiritualität und des Glaubens wieder bewusster werden. (13.12.12)

Unsere Seele ist wahrscheinlich ein bisschen wie eine Homepage oder ein E-Mail-Konto im Zentralserver. Selbst wenn der Computer zerstört wird, selbst wenn kein Blut mehr in den Adern der erschaffenden Person pulsiert, bleiben doch Spuren unseres Bewusstseins, das sich mit dem Bewusstsein der Anderen in der Anderwelt vereinigt hat oder dort schon immer vereinigt war. Vertrauen wir uns dem Leben an, dann trägt es uns, dann werden wir der bunten Fülle unter der Oberfläche gewahr, dann verbinden wir uns mit Unvergänglichkeit. Nur wer sich nie aufs Schwimmen eingelassen hat, entwickelt Angst vor dem Wasser. Glücklicherweise ist es nie zu spät. Die Dimensionen des kosmischen Servers und Internets vor und hinter dem Reich der Dinge können wir zu Erdenzeiten natürlich nur erahnen. Die Entwicklung grenzüberschreitender Friedenstechnologie ist wie die Projektion eines Gottestraumes in unsere Welt hinein. (13.12.12)

In das Licht, das heller strahlt als tausend Sonnen, das uns entflammt, ohne uns zu verbrennen, werden wir eines Tages, hinter der Welt der Zeit, direkt schauen können. Wenn wir in uns gehen, werden wir erkennen, dass es schon heute, hier und jetzt, aus anderen Dimensionen, jenseits vom Illusionenglanz der Dinge wachkitzelnd zu uns rüberscheint und Grüße von uns selbst bestellt. (15.12.12)

Ein zugewuchtertes Feld, ein vereister Boden hat es schwer, die Saat des Neuen in sich aufzunehmen. Der beste Zeitpunkt ist dann gekommen, wenn der Acker aufgelockert, ja durchaus aufgewühlt ist. Obwohl der erste Eindruck der von Chaos sein mag, sind nun die Vorzeichen für Innovation und Wachstum besser denn je. (17.12.12)



"Mama, fängt jedes Märchen mit: 'Es war einmal...' an?"

"Nein, viele fangen an mit: 'Wenn ich gewählt werde...'"


mehr Witze, Kabarett & Comedy finden Sie hier


Meine aktuellen Film-Empfehlungen


Eine Sternstunde aus dem Werk des Kabarettisten Bill Hicks ("It's just a ride" mit deutschen Untertiteln), eingeleitet durch inspirierende Gedanken für ein erfüllteres Leben >>


Maldives - A Video Diary >>


"Fractal Universe - We Are All Connected" >>


One&Only Ocean Club Moments >>


Szenen aus dem Film "INTO THE WILD": Trailer >> , "Best Unsaid" >> , "Felicità" >> , "So Far Away" >>"Weitblick" >> , "L'essenza dello spirito dell'uomo sta nelle nuove esperienze" >> , "Il Mare" >> , "Happiness only real when Shared" >> 


Szenen aus dem Film  "THE FOUNTAIN" von Darren Aronofsky, untermalt mit dem Lied "Together We Will Live Forever" von Clint Mansell aus dem Original Soundtrack >>


Trailer zum Film "THE FOUNTAIN" >>


Der Film  "THE FOUNTAIN" >>


Gedicht von Alejandre Pizarnak: "Árbol de Diana", Strophe 23 (1962) >>


Captain Future: "Die fünfte Dimension" >>


Captain Future - rare scene - childhood of Captain Future


Trailer zum Film "Earth" >>


Trailer zum Film "Oceans" >>


Trailer zum Film "Babel" >>


Trailer zum Film "Night on Earth" >>


Trailer zum Film "Another Earth" >>


Trailer zum Film "2001 - A Space Odyssey" >>


Trailer zum Film "The Road" >>


Trailer zum Film "The Truman Show" >>


Trailer zum Film "Paris je t'aime" >> , Episode von Tom Tykwer aus dem Film "Paris je t'aime" >> , Episode "14eme Arrondissement" von Alexander Payne


Trailer zum Film "Die fabelhafte Welt der Amélie" >>


"CINEMA PARADISO" (Regie: Giuseppe Tornatore) , Trailer zum Film


"NIGHT ON EARTH" (Regie: Jim Jarmusch)

Los Angeles >>

New York >>

Paris >>

Rom >>

Helsinki >>


"VIAGEM A LISBOA / LISBON STORY" (Regie: Wim Wenders) >>


"DAS EXPERIMENT" (Regie: Oliver Hirschbiegel) >>


Trailer zum Film "The Sheltering Sky" >>


Trailer zum Film "Y tu mama tambien" >>


Trailer zum Film "The Motorcycle Diaries" >>


Trailer zum Film "Mein Leben ohne mich" >> , Supermarktszene >>


Trailer zum Film "Das geheime Leben der Worte" >>


Trailer zum Film "Das Meer in mir" >>, Szene "Flug zum Meeresstrand" >>


Trailer zum Film "Der Zauber von Malena" >>


Trailer zum Film "Il Postino" >>


Trailer zum Film "Marcello Marcello" >>


Trailer zum Film "Caro Diario" >>


Trailer zum Film "Il Mostro" >>


Trailer zum Film "La Vita E Bella" ("Das Leben ist schön") >>


Trailer zum Film "Once" >>


Trailer zum Film "Zug des Lebens" >>


Trailer zum Film "Alles koscher!" >>


Für Zeiten, in denen vielleicht ein bisschen in Vergessenheit gerät, was für ein Geschenk es ist, nicht in einen Krieg verwickelt zu sein, in Frieden leben zu dürfen, was sicherlich der Urzustand des Menschen wäre, geriete er nicht in die Fänge der Manipulation machtbesessener Ideologien, kommandiert von Menschen, die keine Zufriedenheit aus sich selbst heraus finden können.

Szene "Landung am Invasionsstrand" aus dem Film "Saving Private Ryan" >>

Trailer zum Film "Kippur" >>


Trailer zum Film "Willkommen bei den Sch'tis" >>


Trailer zum Film "Almanya" >>


Trailer zum Film "To Rome With Love" >>


Trailer zum Film "Lola rennt" >>


Trailer zum Film "3" >>


Trailer zum Film "The Fountain" >>


Trailer zum Film "Der Himmel über Berlin" >>


Szene aus dem Film "Falsche Bewegung" von Wim Wenders >>


Trailer zum Film "The Tree of Life" >>


Trailer zum Film "Paris, Texas" >> ,


Trailer zum Film "Roman Holiday" >>


Trailer zum Film "Palermo Shooting" >> , , Auftritt der "Makina67" >> , "Postcards from Italy" (von der Band "Beirut") >> , "The Rip" (von der Band "Portishead") >>


Szene "So Much Beauty In The World" aus "American Beauty" >>


Leonard Cohen: "Poen" >> , "Angels" >>


Jim Morrison: "An American Prayer" >>


Ein liebenswerter Film über den Zauber des von Herzen kommenden Lächelns: "Validation" (USA, 2007) >>


"Stairway to Heaven" (Sendeturm-Besteigung) ... gut geeignet zur Konfrontation in sensu bei Höhenangst ;-) >>


"Changes to consciosness and the illusion of reality frequency and the matrix 2012" >>


Dem Bewusstsein auf der Spur (Beitrag von 3sat) >>


David I (creating our own reality) >>


"Glücksgefühle" (Vortrag von Prof. Dr. Gerald Hüther im Rahmen von "DenkwerkZukunft") >>


"Eine Nachricht an die Menschheit" (Rede von Charlie Chaplin aus dem Film "Der Große Diktator") >>


"2012 - Time for Change - Trailer"


Contact Intro


Contact Trailer


Contact Space Travel


Contact Part II Journey Through Time & Space


Poesie der Reise (liebenswerter Werbespot)


Im Orbit um Mutter Erde an Bord der ISS Raumstation



*We Are Here: A Pale Blue Dot


*Cosmos Intro

*We Humans Are Capable Of Greatness

*We Are One Planet


Eine aktuelle Debatte: Gibt es die Geheimorganisation der "Illuminati"? 

"The Art of Corporate Mind Control"

Das Stadium der Schafe hinter sich lassen

George Carlin zieht vom Leder in puncto Konsumismus

Peter Licht über die Nicht-Möhre und die Vorstellungs-Gurke

SMOOTH E: "Materialism"

"Consumerism! The Musical"

"Consumerism: A Cautionary Rhyme"

"Defined by Consumption"


Empfehlungen für intelligenten Umgang mit persönlichen Daten bei Facebook für ungetrübte Freude am Kommunizieren ,



*HUMAN Story  

*Who are we?

*What should be the purpose of our species?

*What can one human life mean?


Extraordinary Toroidal Vortices


mehr Filme finden Sie hier


Meine aktuellen Musik-Empfehlungen


Herbert Grönemeyer: "Mensch" >> , "Der Weg" >> , "Flugzeuge im Bauch" >> , "Halt mich" >> , "Du bist Die" >> , "Ich dreh mich um Dich" >> , "Zum Meer" >>


Glen Hansard & Marketa Irglova: "Falling Slowly" >>


Jack Johnson: "You And Your Heart">>


Jack Johnson: "Breakdown" >>


Alexi Murdoch: "Something Beautiful" >>


Pearl Jam: "Amongst the Waves" >>


Pearl Jam: "Better Man">>


Eastern Sun: "Beautiful Being" >>


John Butler Trio: "Ocean" >>


Silbermond: "Krieger des Lichts" >>


Cio D'Or: "Origami Radiomix OceanClub 2007/VJ Heiligenblut"  >>


Ich & Ich: "Vom selben Stern" >> ,


"Joan" (aus Captain Future) >> ,


Valdi Sabev: "We Are Free" >>


Staind: "So Far Away" >>


Pearl Jam: "Just Breathe" >> , "Unthought Known" >> , "Oceans" (Unplugged)


Eddie Vedder: "Guaranteed" >> , "Society"


"The Ocean" Chillout Music


Vasco Rossi: "Eh già" >>


Samuel Barber: "Adagio for Strings" >>


"Part of Something Beautiful" ("Teil von etwas Schönem") >>


CRO: "Bye Bye" >>


Tim Bendzko: "Sag einfach Ja" >>


Valdi Sabev: "Deep Blue Ocean" >>


Die Fantastischen Vier: "Tag am Meer" >> , "Einfach Sein" >>


CRO: "Du" >>


Duran Duran: "Rio" >>


Jovanotti: "La notte dei desideri" >> ,"Tutto l'amore che ho" >> . "Mi fido di te" >>"Baciami ancora" >>


Mark Forster: "Auf dem Weg" >>


Lykke Li: "I Follow Rivers" >>


Silbermond: "Ja" (Klavierversion) >>


Fiva MC: "Hallo" >>


Fiva MC: "Dein Lächeln verdreht Köpfe" >>


Marteria, Yasha & Miss Platnum: "Lila Wolken" >>


Thomas D: "Get on Board" >> (Kommentar des Künstlers im Interview: )


Deichkind: "Bon Voyage" >>


Seeed: "Beautiful" >>, "Aufstehn" >> >> Seeervus an die OzeanClub-Community in Berlin ;-) !!! Peter Fox: "Haus am See" >> , "Alles Neu" >>


XAVAS (Xavier Naidoo & Kool Savas): "Ich schau nicht mehr zurück" >> , Xavier Naidoo: "Dieser Weg" >> , "Zeilen aus Gold" >> , "Bitte frag mich nicht" >> , "Seelenheil" >> ,  "Bist Du am Leben interessiert" >> , "Und" >>




mehr Musik finden Sie hier


Meine aktuellen Text-Empfehlungen


 "Unser Fleischkonsum ist nicht zu rechtfertigen - Wie Schweine unter Massentierhaltung leiden" (Politisches Feuilleton von Hilal Sezgin, ausgestrahlt in Deutschlandradio Kultur am 13.11.2012) >>


"Alles Lüge! - Die Fälschung der Welt" (Manuskript eines SWR2 Wissen - Beitrages von Bestsellerautor Dr. Manfred Lütz [mit Bezug auf sein aktuelles Buch "Bluff - Die Fälschung der Welt", Droemer Verlag])


 "Wie wäre es, gebildet zu sein?" (Festrede von Prof. Dr. Peter Bieri)



Faszination des Lebens auf unserem anbetungswürdigen Planeten (Fotos von Berndt Ebler, Südfrankreich, leicht erreichbar mit der Bahn, Juli 2012)


Herzlich willkommen im Club für Persönlichkeitsentwicklung und Lebenskunst!

Finden Sie sich in einigen der folgenden Gedanken wieder?

  • In gewisser Weise ist das ganze Leben eine Reise.
  • Im Kontakt mit anderen Menschen und unterwegs kann man viel über sich selbst lernen. Selbst wenn ich mir einen schönen Freundeskreis aufgebaut habe, bleibe ich neugierig auf inspirierenden Gedankenaustausch.
  • Ich lege viel Wert auf bewusstes Leben und  darauf, eine eigene Meinung zu entwickeln. Ich lasse mir nicht von anderen Vorschriften machen, woran ich zu glauben habe. Ich übernehme Verantwortung für meine Entscheidungen.
  • Obwohl ich weiß, dass es manchmal schwer ist, sich aufzuraffen und Neues zu wagen, ist es mir lieber, in guter Gesellschaft aktiv zu sein als stundenlang vor dem Fernseher herumzusitzen und darüber nachzugrübeln, warum die Jahre wie im Flug vergehen und ich keine Seelenverwandten kennenlerne.
  • Mit mir ist nicht gut Kirschen essen, wenn man mich zwingen will, eine Sichtweise zu übernehmen, nur damit oberflächliche Harmonie herrscht oder weil es die Tradition angeblich so verlangt. Einengende Fesseln möchte ich abstreifen.
  • Ich bekenne mich dazu, dass ich recht wählerisch bin bei der Auswahl meiner Freunde und Freundinnen. Gelegentlicher "Small Talk" ist OK, doch es nervt mich ehrlich gesagt, wenn es darüber nicht hinausgeht.
  • Es ist nie zu spät dafür, weitere wertvolle Erfahrungen und Ideen zu sammeln.
  • Die Vielfalt auf unserem Planeten fasziniert mich und ich will noch mehr Verständnis entwickeln für das Ungewohnte und Fremde.
  • Aufrichtige Gespräche, in denen ich mich gesehen und verstanden fühle, sind ein kostbarer Schatz. Im bisweilen hektischen und anonymen Alltag kommt dies leider oft zu kurz.
  • Wenn ich mir klarer werde, was mir persönlich wichtig ist, kann ich mein Leben gezielter und selbstbewusster nach meinem Geschmack gestalten.
  • Am schönsten sind Reisen, die ihren Zauber auch zu Hause entfalten.
  • Ich kann mich begeistern für Selbsterkenntnis und seelisches Wachstum.
  • Ein Berg kann noch so hoch wirken ... Schritt für Schritt lässt er sich besteigen und mit jedem Höhenmeter gewinne ich neue Aussichten.
  • Manchmal verspüre ich Lust, neuen Schwung in mein Leben zu bringen.
  • Ein Club von Gleichgesinnten, die sich persönlich weiterentwickeln wollen, die dabei jedoch Abstand nehmen von Vereinsmeierei und Überheblichkeit gegenüber anderen ... das gefällt mir.
  • Ich möchte in Bewegung bleiben, geistig und körperlich, dabei auf Extreme verzichten und eine Balance pflegen aus Aktivität und Ruhe.
  • Es ist ein lohnendes Abenteuer, mir selbst und anderen Menschen zu begegnen.
  • Die Gemeinschaft von Menschen, mit denen ich auf einer Wellenlänge bin, tut mir gut. Dabei achte ich auch darauf, mir meine Freiräume zu bewahren, nichts nur deswegen zu tun, weil es andere von mir erwarten.
  • Ich möchte Werte spüren, Werte erleben, Werte verwirklichen.
  • Das Leben wird reicher, wenn ich dem Wesentlichen mehr Raum gebe.
  • Höhen und Tiefen gehören zum unverwechselbaren Profil des Lebens dazu.
  • Auch im Vertrauten lässt sich  das Neuland entdecken.
  • Gelassenheit und innere Freiheit sind für mich kostbare Güter und Lebensziele.


... wenn ja, dann sind Sie wohl an der richtigen Adresse gelandet ;-)

Dieses Projekt ist über mehrere Jahre während meines Studiums und meiner beruflichen Tätigkeit gereift. Teilweise war es Bestandteil meiner Gedankenwelt, teilweise verwirklichte ich es im Rahmen praktischer Initiativen, bei denen es vor allem darum ging, Menschen ein Forum für Begegung zu bieten. Ideen brauchen oft sehr lange, um die Gestalt zu finden, in die sie letztendlich hineinwachsen wollen. Die Namensgebung "Psychologie-Luftlinie" kristallisierte sich am 21. Mai 2012 in Marseille heraus,  im Rahmen einer Reise, die ich mit meinem Vater unternahm, die mich über die Côte d'Azur, Newcastle upon Tyne in Nordostengland, Edinburgh in Schottland und Deggendorf in Bayern schließlich wieder zurück nach Trier im schönen Moselland führte. Auf dieser Tour besuchte ich Menschen, die mir am Herzen liegen und ich konnte spüren, wie gut es tut, in einer lebendigen Verbindung mit Anderen zu stehen und durch das Unterwegssein Bewegung ins eigene Schaffen zu bringen, Neues anzupacken.

Warum "Psychologie-Luftlinie"? Mein Anliegen ist es, Menschen, die Inspiration, Unterstützung und Kontakt suchen und Wert auf qualitativ hochwertige, professionelle und vertrauenswürdige Begleitung in allen Lebenslagen legen, einen möglichst direkten und komfortablen Zugang zu passenden Angeboten zu ermöglichen. Die kürzeste Entfernung zwischen zwei Orten auf dieser Welt ist die Luftlinie. Nicht einmal Flugzeuge können genau diesen Weg wählen. Telefon und Internet bieten neben der Phantasie die beste Annäherung an diese schnellstmögliche Verbindung. So war es für mich naheliegend, bei der Bezeichnung des Internet-Auftritts meines Unternehmens an den Traum von der fliegerisch leichten Erreichbarkeit zu denken.

Dass psychologische Angebote oft erst dann in Anspruch genommen werden, wenn einem die Sorgen schon über den Kopf gewachsen sind und sich schwerwiegendere Symptome bemerkbar machen, liegt oft daran, dass viele Hürden zu überwinden sind, bis man in den Genuss seriöser Beratungs-, Coaching- und Psychotherapieangebote kommt, dass lange Wartezeiten in Kauf zu nehmen sind und dass eine geeignete Praxis womöglich auch weit entfernt vom eigenen Wohnort liegt. Die "Psychologie-Luftlinie" will es ihnen hier so leicht wie möglich machen.

Letztendlich handelt es sich bei "Psychologie-Luftlinie" um eine lebendige, interaktive Zeitschrift zur Förderung der Persönlichkeitsentwicklung und zur Steigerung der Lebensqualität. So anregend Bücher und Magazine auch sein mögen ... wenn Sie erst einmal erworben sind, stehen Sie oft im Regal, verlieren vielleicht sogar einen Teil ihrer Aktualität und man kann mit ihnen nicht viel mehr anstellen, als sie zu lesen und bestenfalls die darin enthaltenen Impulse im eigenen Leben zu erproben. Dies hier ist eine Zeitschrift zum Mitmachen, die stetig weiterwächst, mitten in unserer Zeit eben und die auch Ihre Handschrift tragen kann. Gleichzeitig ist sie Sprungbrett in eine bunte Palette der Angebote für Selbsterfahrung, inneres Wachstum, Entspannung und seelisches Gleichgewicht, Aufbau fördernder und verständnisvoller zwischenmenschlicher Beziehungen sowie inspirierendes Kennenlernen unseres Planeten. Gewissermaßen ist die Seite wie ein Baum aufgebaut, der sich immer weiter verästelt und Sie im besten Falle zu Früchten leitet, die Ihnen schmecken und Ihnen guttun. Auch Ihr eigenes Leben ist wie ein Baum, der in den klimatischen Schwankungen der Höhen und Tiefen, durch ihre Erfahrungen und zwischenmenschlichen Beziehungen gewachsen ist. Wenn Ihr Lebensbaum mit diesem Impulsnetzwerk hier in Berührung kommt, kann ein reger Austausch entstehen, der Weiterentwicklung fördert. In diesem Zusammenhang kann auch das Wort "Synergien" verwendet werden. Sie sind also herzlich dazu eingeladen, mir per E-Mail Zitate, die Sie berührt haben und natürlich auch eigene Gedanken zukommen zu lassen. Ich werde diese Beiträge dann auf "Psychologie-Luftlinie" veröffentlichen. So erhalten Sie ein Forum für Ihre Wünsche und Ideen und bekommen auf diesem Wege auch ein weltweites Publikum.

Sie können auch andere Menschen auf Psychologie-Luftlinie aufmerksam machen. Wir freuen uns alle auf anregende Begegnungen. Durch Kontakt, Gedankenaustausch und aktives Handeln verbessern wir unser Lebensgefühl und bleiben in einem tieferen Sinne jung.

Ich erlaube mir eine sehr persönliche Anmerkung: Auf dieser Welt wird neben all den lobenswerten und liebenswerten Inititativen, über die leider viel zu wenig berichtet wird, allerhand Unsinn verbreitet, bei dem es oft nur darum geht, große Konzerne noch größer zu machen und blind einer sehr oberflächlichen Vorstellung von Wachstum zu dienen. Effizienzdruck und die ständigen Aufforderungen zum Konsum machen den Menschen jedoch nicht glücklicher, sondern oft eher zur gehetzten Marionette. Natürlich möchte ich mit meinen Ideen auch Geld verdienen, um gut über die Runden zu kommen und klug zu investieren, aber es geht mir um viel mehr als nur um materielle Ziele. Ich bekenne mich gerne dazu, dass ich im Rahmen meiner Möglichkeiten die Welt auch zu einem besseren Ort machen möchte. Ich finde, es ist an der Zeit, mit Unterstützung der prinzipiell fantastischen Erfindung des Internets dazu beizutragen, dass wieder mehr guter Geist in die Welt kommt und dass Menschen die Möglichkeit bekommen, ihrer Kreativität Ausdruck zu verleihen und dadurch Kontakt mit Gleichgesinnten aufzubauen. Je mehr sich die intelligenten, selbständig denkenden und verantwortungsbewussten Menschen der Gesellschaft vernetzen, je mehr sie die Rhetorik und Täuschungsmanöver der am Machterhalt interessierten Kreise durchschauen, desto mehr setzt sich das Ideal der Aufklärung durch und desto mehr kann auch im besten Fall auf die politischen und wirtschaflichen Kräfte konstruktiver Druck ausgeübt werden, im Interesse einer nachhaltigen Kursveränderung. Das kann durch Entscheidungen beim Wahlgang geschehen, vor allem aber durch den Stil, wie wir im Alltag mit uns selbst und unseren Mitmenschen umgehen. Was ich damit sagen möchte ist, dass die Vernetzung von Menschen, die mehr Freiheit und Bewusstsein in ihr Leben bringen möchten, auch eine gesellschaftsverändernde Dimension annehmen kann, auch wenn es nur ein Tropfen ist, der am Ende aber mit vielen anderen zusammen den Stein in eine schönere und lebenswertere Form bringt.

Zunächst einmal geht es jedoch um Ihr ganz persönliches Leben. Ich wünsche Ihnen, dass Ihnen die Lektüre der kontinuierlich wachsendenden Palette an Beiträgen Lust darauf macht, hie und da einen neuen Blick auf die Welt einzunehmen und dass Sie Bekräftigung finden für werteorientierte Veränderungsbestrebungen, denen Sie noch mehr Auftrieb verleihen möchten. Am intensivsten wird Wandel durch zwischenmenschliche Begegnung angeregt. Deswegen möchte ich Sie im Rahmen dieser Online-Zeitschrift auch auf psychologische Angebote aufmerksam machen, die sie per Luftlinie oder auch im direkten Kontakt unter vier Augen in Anspruch nehmen können, um ihre Ziele und Träume noch besser verwirklichen zu können. Ich stehe Ihnen mit einem Team von Diplom-Psychologinnen und Diplom-Psychologen zur Verfügung. Alle Mitarbeiterinnen und Mitarbeiter habe ich während meiner Ausbildung und beruflichen Tätigkeit persönlich kennen- und schätzengelernt. Im Rahmen meines Dienstes in psychosomatischen Reha-Kliniken und als Leiter des Begegnungskreises Trier wurde mir klar, wie wichtig für Ratsuchende der Kontakt zu Menschen mit ähnlichen Anliegen und einer passenden Wellenlänge ist. Das gilt nicht nur in beschwerlichen Phasen. Deswegen biete ich Ihnen auch die Gelegenheit, im Rahmen von Kennenlern-Treffen, Seminaren und Reisen die inspirierende und wohltuende Gesellschaft anderer kultivierter, weltoffener und entwicklungsfreudiger Personen zu genießen und auf diesem Wege Ihren Bekanntenkreis ganz nach Ihrem Geschmack zu erweitern. Wer weiß ... vielleicht entstehen daraus ja sogar Freundschaften oder "mehr" ;-) Erfahrungsgemäß kann durch starke Erlebnisse und ähnlich gelagerte Interessen viel Nähe entstehen.

Mit Hilfe der "Psychologie-Luftlinie" finden Sie auch in Lebenskrisen kompetente Beratung. Manchmal kommt es eben vor, dass man zu einem Problem keine Lösung findet und das Gefühl hat, sich im Kreis zu drehen. VitalaVia hat sich zum Ziel gesetzt Ihnen dabei zu helfen, einen Weg aus der Krise zu finden. Als Psychologen und Psychologinnen gehen wir individuell auf Ihre Sorgen ein und finden gemeinsam mit Ihnen eine Lösung aus der schweren Lebenssituation, fördern Sie bei der Umsetzung der Lernerfahrungen aus einer Reha oder stützen sie auf der Durststrecke bis zum Beginn einer Psychotherapie.

Ganz egal, ob Sie ein aus den Fugen geratenes Leben wieder ins Gleichgewicht bringen wollen, oder ein im Grund recht gut laufendes Leben aufpeppen, Ihre Potentiale zur vollen Entfaltung bringen wollen ... wir sind für Sie da und begleiten Sie auf dem Weg Ihres Wachstums.

Genießen Sie das gute Gefühl, als ganze Person gesehen zu werden und nicht nur als Konsument oder nützliche Arbeitskraft.

Meine Initiative ist unabhängig von anderen Institutionen, Unternehmen und Geldgebern und kann sich dadurch frei an ethischen Werten im Interesse eines gesünderen und aufgeklärten Zusammenlebens orientieren. Dafür stehe ich mit meinem Ehrenwort.

Lernen Sie VitalaVia kennen und erfahren Sie Wissenswertes zu unseren Leistungen. Wenn wir etwas für Sie tun können, freuen wir uns auf Ihre Kontaktaufnahme!

Erleben Sie mit, wie sich diese "Skulptur des Bewusstseins" entwickelt und nützen Sie die Chance, teilzunehmen an diesem kreativen Projekt mittem im Alltag! Wenn wir schöpferisch tätig sind, werden wir noch gesünder :-)

Stellvertretend für Ihr Team für mehr Balance und Lebensfreude grüßt Sie herzlich

Ihr Berndt Ebler



Liebenswerte Tierfilme zum Herzerwärmen


Mini Pig


Eine total versaute Zirkusnummer


Süßes Küken


Tierische Konversation


Glückliche Kühe.1


Glückliche Kühe.2


Glückliche Kälber.1


Glückliche Kälber.2


Tiere als komödiantische Naturtalente




America's Funniest Home Videos / Animal Clips


10 Beispiele für Tiere mit Ecken, Kanten und weichen Rundungen


Verspielte Gesellen


Sprechende Tiere auf BBC


Husky Mishka sagt "I love you"


Geradezu unglaubliche Tierfreundschaften:

*Krähe und Katze

*Hund, Katze und Ratte

*Ratte und Katze

*Gemischte Paare


Frisch eingetroffen aus dem Süden: Impressionen einer Italienreise zwischen Rom und Neapel >> Reise-Video-Galerie / Italien - Edition Luftlinie / Latium

zum Beispiel >>

Musik ist in der Luft


Sie haben Lust auf das geschriebene Wort? ...

Fündig werden Sie dann vor allem im Gebäude "Gedankensammlung" mit seinen drei Räumen. In einem von Ihnen finden Sie auch mich und die Ideen, die so von Tag zu Tag an die Tür klopfen ;-)


Wenn Sie die Registerkarte "Impulse für bewusstes Leben" wählen ...

und dort die Rubrik "Beiträge im Internet" anklicken, finden Sie eine wachsende Sammlung der schönsten und aufsehenerregendsten Schätze, die sich im World Wide Web, diesem faszinierenden Treffpunkt für menschlichen Geist, Erkenntnis und Phantasie finden lassen. Ich wünsche Ihnen eine spannende Entdeckungsreise!


Psychologische Beratung und Coaching........... (NEU: jetzt auch via Videotelefon Skype® / Webcam)


Ziel der kognitiven Verhaltenstherapie ist es, Denk- und Verhaltenmuster aufzulockern, neue Handlungsspielräume zu öffnen und längerfristig das Wohlbefinden zu verbessern, auf der Grundlage eines gefestigten Selbstwertgefühls. Wir orientieren uns im Rahmen unserer Beratungs- und Coaching-Angebote an diesem Ansatz, wenngleich wir keine Psychotherapie im engeren Sinne anbieten. So oder so ist Dreh- und Angelpunkt das hilfreiche Gespräch, durch das sich neue Perspektiven ergeben. Gemeinsam können wir so eine Verbesserung Ihrer Situation und erarbeiten und gute Voraussetzungen für die Rückkehr der Lebensfreude schaffen.


Weitere Informationen zu psychologischen Angeboten finden Sie hier


Das Team

das hier ist zwar nicht unser Büro, doch das Bild gefällt mir ;-)

Mit uns über Persönliches zu sprechen, setzt großes Vertrauen voraus. Deswegen möchten wir uns Ihnen gerne vorstellen. Wer wir sind, können Sie auf der Seite "Unser Team, Ihr Team" nachlesen.


Phantasie-Ausflüge zur Entspannung


hier ein paar Beispiele aus dem Erlebnisraum "Impulse für ein bewusstes Leben" >>

Wunder des Lebens


Elsinore: Breathing Light

Nena: Liebe Ist

sayCet: 15

Segelfliegen in Eichstätt, Naturpark Altmühltal, Bayern

Fischland, Darß und Zingst, Deutsche Ostseeküste

Durch die Nacht in einen neuen Tag (Iglooos - "//Aque")

Buckethead: Planeta

Die Küste Südkaliforniens aus der Vogelperspektive

Newcastle-upon-Tyne, Nordostengland und Italien im Fluss der Zeit

A Day at the Coast, Northumberland, Nordostengland

Ein Tag auf Sardinien

Trance d'Amour: La Côte d'Azur

Deep Space Network: XploreXpandeXperience

Maya Bay, Koh Phi Phi, Phang Nga Bay | Phuket, Thailand

Korsika - eine magische Insel

Im Formationsflug mit dem eigenen Schatten über Stränden Korsikas

Das Licht Korsikas umweht vom Wind der Zeit ,

Korsika aus der Luft

Menschen begegnen auf der Insel Giglio ("Lilie") / Toskana

Cap Roux bei Anthéor, Esterel-Küste, Südfrankreich aus der Sicht eines Modellflugzeuges ,

Schwimmen auf den Fidji-Inseln

Im Orbit unseres wunderbaren Planeten

Laid Back: Happy Dreamer

Beach and Sky / Strand und Himmel (Cap Taillat bei Ramatuelle / Côte d'Azur und Bucht von Santa Giulia / Korsika)

Beanfield: Charles

Herbert Grönemeyer: Mensch



Aktuelles Satellitenbild

Spaziergang am Meer

Verbindungen mit öffentlichen Verkehrsmitteln

Verkehrsclub Deutschland


Schön, dass Sie hierher gefunden haben. Ich möchte Ihnen ein paar Gedanken von Bill Hicks (leider bereits verstorben) und anderen klugen Menschen mit auf den Weg geben. Von Bill Hicks erfuhr ich, während ich diese Internetseite nach und nach aufbaute. Wir können seine Ideen weiter transportieren und diesen Planeten zu einem besseren Ort machen. Ja, es ist möglich :-)


Viel Freude beim Genießen des Hier und Jetzt!

Zauber der Begegnung

All Time High


It's Your World


Nun werden wir gemeinsam weiter sehen und entscheiden, wohin die Reise geht.


Poesie der Schlag- und Streichelwörter

Abîme de Bramabiau Abruzzen Abschied abstrakt abstrakte Kunst Abstraktion
Abulafia Adria Adriatisches Meer Aegadian Islands Aeolian Islands Aeolus
Ägadische Inseln Ägäis Ägäische Inseln Ägypten Äolische Inseln Äolus Äther ätherische Kraft Ätherleib Ätna ABC-Modell der Gefühle Abenteuer Abhängigkeit Ablehnung Abneigung Abraham Joshua Heschel Absolventen Absolventinnen Abwehrmechanismen Abwertung Achintya Bhedabheda Achtsamkeit Adresse Advaita-Vedanta Ärger ärgerlich ärgern Ästhetik Äther Affekt Affektive Störungen Afrika Afrikanisches Meer Agamas ahamkara Ahnengeist ainigma Aiolos Airstrip Ajapa-Mantra Aka Aka-Chord Aka-Cord Akademie Akademiker Akademikerinnen Aka-Faden Aka-Feld Aka-Flow Aka-Fluss Aka-Gedankenform Aka-Netz Aka-Schnur Aka-String Aka-Telefon Aka-Vibration Aka-Welle Aktion aktiv Aktivismus Aktivitäten akustisch Akzeptanz Akzeptanz- und Commitmenttherapie Al-Ghazali Albert Einstein Alborán-Meer Algarve Alghero Alicudi Allah Alleinlebende Aloha Alpen ἄλφαAlphabet Alpha Centauri Alpha Wave Alternative Medien versus Mainstream alternativer Lebensstil Alternativheilverfahren Alternativmedizin Altruismus Professor Dr. Elmar Altvater Das Ende des Kapitalismus wie wir ihn kennen Alumni Amalfiküste Ambient Music Ambiente Ambiguität Ambiguitätstoleranz Ambulanz Amerika Amore Amour Insel Amrum Anamnese Anderwelt Andrew Newberg Anduze Anerkennung Anfang Among Angels Angriff Angst Ängste Aniene Animus und Anima Anita Anliegen Anorexie Anregungen Ansbach Antarktika Antarktischer Ozean Antipathie Antithese Antworten 'ao'ao Lono Ku Kane Kanaloa Po Ao Apennin Apokryphen Apostel App Appennini Approbation approbiert Apulien Arabisches Meer Arafurameer Arafurasee Aralsee Aranyakas Ararat Arbeitsklima Arbeitslosigkeit Arbeitsplatzkonflikte Arbeitsstörungen Arcade Fire Archetyp Archipel de Riou Argentinien Arktis Arktischer Ozean Aroma Artemis Asana-Position Asanaprayoga The Ascent of Humanity - The Age of Separation, the Age of Reunion, and the Convergence of Crises that is birthing the transition Ashram Asien Askese Assessment Center Astralleib Astralreisen Astralwelt Astrologie Astronomie Atem Atembeschwerden Atemübungen Atharvaveda Atlantik Atlantischer Ozean Atlas Atma Vichara Atman Atmosphäre Attraktivität Aude Audit Aufbruch Aufdecken Aufgeschlossenheit Aufklärung Aufmerksamkeit Aufstand Aufstieg Aufwachen Auge Augen Augenblick Augustinus 'aumakua Sri Aurobindo Ausbildung Ausdauer Ausfallhonorar Ausflug Ausgangssituation ausgeliefert Ausland außerkörperliche Erfahrung Aussichtsbalkon Aussichtsterrasse Australien Auswahlverfahren Autarkie Authentizität Autogenes Training Automatisierung Autonomie Autopoiese
Autor Avebury Awake Awakening Axon
آيةAya āyat al-kursī āyat an-nūr Azoren-Hoch Baden
Badevergnügen Backcountry Flying Backcountry Pilot Bahai Bahn Bahnreisen
Bahnvergnügen Balearen Balearen-Meer Ballon Ballonfahren Balsam für die Seele Balsamba Baltisches Meer La Bambouseraie d'Anduze Bammel Bandhas Barentsmeer Barentssee Bauchgefühl Baum der Geduld Baum des Lebens Baumkuchen Bayern Beats Beaufortmeer Beaufortsee Beauty Aaron T. Beck Don Beck Spiral Dynamics Klaus Jürgen Becker Die Kraft der Selbstverantwortung Bedauern bedrückt Bedrücktheit Bedürfnisaufschub Bedürfnisse Befinden Befindlichkeit beflügelnd Begabung Begegnung Begegnungskreis Begeisterung Begleiterscheinungen Begrüßungsritual Behagen Behandlung Bekannte Belletristik Belohnung Beltane Belvédère Bengalisches Meer Beobachtung Beratung Beratungsteam Berge Beringmeer Beringsee Berndt Albin Ebler Beruf Berufsausbildung berufsbegleitende Ausbildung Berufseinstieg Berufsleben Berufung Besorgnis Bethlehem Betriebspsychologie Beweis Bewerbung Bewertung Bewertungsmuster Bewertungssystem Bewerbungstraining bewusste Lebensgestaltung Bewusstsein Bewusstseinswandel Beziehung Beziehungen Beziehungsqualität Bezugspunkt Bezugsrahmen Bezugssystem Biblioteca Medicea Laurenziana Bild Bilder Bilderberger Bildung Bildungslandschaft Bildungsreise Binaural Beats Bindung Bindungsfähigkeit Bindungsstil Bindungstheorie Biologische Psychologie Beats Beltane Bidean nam Bian bildende Kunst Bildung Biographie biopsychosozial bird's eye view Biscaya bisexuelle Seele Blickkontakt blickshirt Blimey Cow Messy Mondays Blüte Blütezeit Blume des Lebens BND Bob Dylan Bringing It All Back Home Börse David Bohm book Boot I Borghi Più Belli d'Italia Bormes les Mimosas Botschaft Boulder Creek Boykott Bozava Brac Brahman Brahmanas Brainstorming Brainwave Entrainment Brandung Breitengrad Brief des Hermes an Asklepius Britische Inseln Bruchstück einer Rede von Asklepius an den König Bruder Klaus Brügge Bruges Brugge Buch Buchstaben Buddha Buddhismus buddhistisch Bücher Bugarach Bulimie Burnout. Caesar von Hofacker Calanques California Campus Cantobre Canyon Capraia Capri Carcassonne Carl Albrecht Carl Sagan Carmel Caroux Castel del Monte Catania Causses C.G. Jung Celestine Cervara di Roma Cevennen Cévennes Chakim libba Chakra Chakren Chance Chancen Chancengleichheit Change Chaos Chaos de Montpellier-le-Vieux Chaos de Nîmes-le-Vieux Chaostheorie Charakter Charisma Danny & Charlie Charme  Belvédère du Chassezac Chemtrails Chiffre Chiffriermaschine Chillout Music Chinesisches Meer Christentum christlich Christus chronisch chronische Schmerzen Church CIA Cinque Terre Clemens von Alexandria Clint Mansell Club City Cloud Seeding Clubreisen Coaching Code Coleman Barks Collioure Comedy Community Computer Halbinsel Conero Consciousness Conspiracy Detection Conspiracy Theory contemplatio Coping Copingrepertoire Copingstrategien Corniche des Cévennes Corniglia Corporate Social Responsibility Corpus Hermeticum Corse Cosimo de Medici cosmic consciousness CosmicRevolutionKS Cosmos Côte d'Azur Courage La Couvertoirade covert action Creation Credit Points Cres Critical Mass Crop Circles Cross CSR cveitch cymatics. Dänische Inseln Dag Hammarskjöld Dalai Lama Dalmatien Dankbarkeit Danny & Charlie Daodejing Daoismus Daoistische Mystik Dardanellen Das Allgemeine Gespräch Das Größte Übel für die Menschen ist die Unwissenheit in Göttlichen Dingen Das Gute ist Gott allein und nirgends Anderswo Das Heilige Abendmahl Das Rote Buch Das Umgreifende Datenschutz Dating David Lynch David Wilcock Dechiffriermaschine Defizit Deggendorf Demiurg Demonstration Denkanstöße Denken Denkmuster Depression Depressionen Der Geist an Hermes Der Heilige Gral Der Menschenhirte des Dreimal-Großen Hermes Der Mischkrug oder die Eins Der Schlüssel Der Unbewegte Beweger Der verborgene Gott ist völlig offenbar Derwisch Desensibilisierung Le Dessous des Cartes Destinationen Deutsche Inseln Deutschland Deutschpop Deutschrock Dhikr Dhikrullah Dhyanayoga diadrome Fische Diagnose Diagnostik Dialog Die Bundeslade Die Heilige Rede Dies Natalis Solis Invicti Dimensionale Diagnostik Dimensionen Diplom Diplom-Psychologe Diplom-Psychologin Disclosure Project Distanz Divine Pymander Divinity DNA Dogma dogmatisch Dogmatismus Domain Domainhandel Domainmarktplatz Domainverkauf Domizile Dopamin Dortmund Douch Dourbies Dover Channel dreidimensional Dreieck Dreieinigkeit Dreifaltigkeit Drittes Auge Drohnen Druck Dschalal ad-Din ar-Rumi Du Dubrovnik Hans-Peter Dürr Düsseldorf Duft Dugi Otok Durchgangshöhle Durst Dvaita-Vedanta Dvijas Dysthymia. EAP EarthApp Eber Echtheit Edgar Cayce Edinburgh Edition Egoseele Ehe Eichstätt Eignungsdiagnostik Eindruck Einfälle Einfluss einflussreich Einheit Einpassung einsam Einsamkeit Einsatzbereitschaft einseitige Hypothese (gerichtete Hypothese) Einsicht Einsiedler Einssein Einstellung Einstellungsveränderung 21 einundzwanzig 21.12. Einundzwanzigster Zwölfter Einzelgespräche Einzeltherapie Eisenbahn Charles Eisenstein Ekstase ekstatische Glückseligkeit Elba Elemente Elektra-Komplex Albert Ellis Eltern Elternschaft E-Mail Emanation Emanuel Swedenborg Emanzipation EMDR Emotion emotionale Intelligenz emotionale Kompetenz emotionale Störungen Empathie Empfehlungen Empfindung Empirische Forschung Employee Assistance Program Ende Endorphine Energie Energiefluss Energieorte Energiezentrum Engagement Engel England Englisch Englischer Kanal English Channel αἴνιγμαEnigma Enlightenment Ensemble Ibn Arabi Entdeckung Entdeckungsreise Enthusiasmus Entrümpelung Entschleunigung Entspannung Entspannungsfähigkeit Entspannungsmusik Entspannungstherapie Enttäuschung Entwicklung Entwicklungspsychologie Entwicklungsraum Entwicklungsstörungen Ephesus Er ist Ich, Ich bin Er. Erblassen erblich bedingt Erdatmosphäre Erde Eremit Eremitage Eremo di San Domenico Erfahrung Erfolg erfolgreich Erfolgsaussichten Erfolgsorientierung Erfolgswahrscheinlichkeit Erfüllung Ergotherapie Erholung Erinnerung Erkenntnis Erkenntnisreisen Erkenntnisspur Erlangen Erlebnis Erlebnisatlas Erlebnisreisen Erlebniswelten erlernt erlernte Erleuchtung Erlösung Muster Erlösungsweg Ernährung Ernährungsberatung Ernährungspsychologie Ernen Eros Erotik erotisch erregend erregt Erregung Erregungsniveau Erröten Erstbeweger erste Materie ersten Blick Erstis Erstsemester Erwachen Erythrophobie Erzählung esprit de corps Essen Essener Essstörung Essstörungen Ethik ethisch Etna Eugen Drewermann Eugene d'Aquili Euphorie EU Eurasien Europa evangelisch Evangelium Events Everything is OK The Love Police Évora Existenz Existenzialismus Existenzielle Reflexion Exkursionsseele Exosphäre Experiment Experimentelle Psychologie Experimentierfreude Experte Expertin Expertise Exploration Extraversion extravertiert extrinsisch Exzellenz Exzess. Facebook Facharzt Fachärztin fächerübergreifend Fachkompetenz Fähigkeiten Fairness Faktor Fünf - Die Formel für nachhaltiges Wachstum Fallschirmspringen familiär familiäre Normen Familie Familienaufstellung Familiengründung Familienleben Familienschutzgeist Familientherapie Familienzusammenhalt Fantasiereise Faraglioni della Madonna Faraglioni di Calzo I Faraglioni di Maria Rosa I Faraglioni di Mezzogiorno Favignana Fehlhandlungen Fehlleistung Insel Fehmarn Feiern feinstofflich feinstoffliche Erweiterung unseres Weltbildes feinstoffliche Ebene feinstoffliche Energie feinstoffliche Welt feinstofflicher Körper feinstoffliches Erleben Ferien Ferner Osten Fernsehen Fertigkeiten Fest Festhalten Feuer Richard Feynman Fibonacci-Folge Filicudi Filme Finanzen Una Finnegan Firehose Fisch Fischland Darß und Zingst Fiumicino Fixierung Flash-back Flexibilität Fliegen Flirt Flirten Flourish Flow Flower of Life Flowerleben Paradigm Shifting Flowetry Flugausbildung Flughafen Flugplatz Flugreisen Flugsimulator Flugzeug Fluss Flussreisen Flyer Fokaltherapie Fokus Förderung Formbildungsursachen Fortschritt Forum Fotograf Fotografie Fotos Fragen Fragment fragmentarisch Fraktalgeometrie Frankreich Französisch Französische Inseln Max Freedom Long Frei Freie Energie Freie Assoziation Freiheit Freiheitsgrade Freiheitskampf Freiseele Freizeit Freizeitaktivitäten Freizeitforschung Freizeitpsychologie Fremdsprachen Frequency Frequenz Freud Freude Freund Freunde Freundeskreis Freundin Freundinnen Freundlichkeit Freundschaft Friede sei mit euch, Freunde! Friede, Friede! Frieden Friedrich Weinreb Frustration Frustrations-Aggressions-Hypothese Frustrationstoleranz frustrieren frustriert FSB Fügung Fühlen Führung
Führungseigenschaften Führungspersönlichkeit Führungsstärke Führungsstil fünf Elemente 5125 Fuerteventura fundamental fundamentaler Attributionsfehler Fundamentalismus
Funken der Erleuchtung Fusion. Gaeta Galaxie Galaxienhaufen Galaxy Galerie
Gallo Lungo Ganges Ganzheitlichkeit Gard La-Garde-Guérin Gardon Gargano Garten Eden Gauß Gebirge Geborgenheit Gebot Jean Gebser Geburt Gedächtnis Gedächtnistraining Gedanken Gedankenaustausch Gedankenbild Gedankensammlung Gedicht Gefühl Gefühlsklärung Gefühlskonsequenz Gefühlsleben Gefühlswelt gefühlvoll Gegenkonditionierung Gegenübertragung αἴνιγμαgeheim Geheimbund Geheimgesellschaft Geheimnis Gehirn Geist Geist eines verstorbenen Verwandten geistig geistlich Gelassenheit Gelassenwerden Gelbes Meer Geld Geldanlage Gelingen Gemälde Gemeinschaft Gemeinschaftsgefühl Gemeinschaftsorientierung Generalisierung generische Begriffe genervt Genesung Genetik Geniertheit Genießen Genitale Phase Genoa Genova Genua Genuss Genussfähigkeit Geo Engineering Geheimdienst Gerechtigkeit Gershom Scholem Geruch Geruchssinn Geschäft Geschichte Geschmack Geschmackssinn Gesellschaft gesellschaftliches Engagement Gespräch Gesprächstherapie Gestalttherapie Gestaltungstherapie Gesundheit Gesundheitsförderung Gewalt Gheranda Gherandasamhita धेरंडसंहिता Giannutri Giglio Gikatilla Giordano Bruno Gipfel Giraglia Gläserner Bürger Glauben Glaubenssätze Glaubensvorstellungen Gleichgesinnte Gleichgültigkeit Glen Coe Glencoe Glück Glücksfähigkeit Glücksfaktoren Glücksforschung Glückwunsch Gnosis Gnostiker God Godfrey Reggio göttlich Göttliches Selbst Goldener Schnitt Goldinseln Goldjunge Golf von Bengalen Golf von Biscaya Golf von Lyon Golf von Lion Golfe du Lion Golf von Mexiko Golf von Neapel Golfo dei Poeti La Gomera Google Earth Google Maps Gorges Gorgona Gott Gottesbeweis Grächen Gran Canaria Klaus Grawe Konsistenztheorie Great Transition Green Economics Green New Deal Greenwashing Gregg Braden Griechische Inseln Großbritannien Größenfantasien Größenideen Großstadt Grundbedürfnisse Grunderregungsniveau Gruppen Gruppendynamik Gruppengespräch Gruppenreisen Gruppentherapie GT Güte Gütekriterien Gustave Le Bon. Habituation Hadith Hafen Hafenstadt Halbinsel Hallig Haltung hamsa Hand Hände Handlung Handy Harndrang Andrew Harvey Hass Hathapradipika हठप्रदिपिका Hatha-Yoga Hathayogapradipika Hauchseele Hawaii hawaiianischer Schamanismus Heartmath Institute Heaven Hedonismus Heidentum heilig Heilige Geometrie Heilige Berge Heilige Orte Heilung Heiterkeit Hérault Herausforderung Hermes Trismegistos Hermes der Dreimal-Große an Asklepius Hermes der Dreimal-Große an Tat Hermetic Hermetik Herz Herzensruhe Herzensweisheit Herzrasen Herzstiche Herzzentrum Bill Hicks Hidden Beach Hidden Canyon Hidden Lake Insel Hiddensee Hier und Jetzt Hierro Kurt Hiller Himalaya Himmel Hindu Hinduismus hinduistisch Hinduistische Mystik Hingabe Hip Hop Hobbies Hochbegabung Hochschule Hören Hoffnung Hoffnungsfunken Hoffnungsschimmer Höheres Selbst Höhlengleichnis Hörsaal Hohes Selbst Hohn Jan Udo Holey holotrop Holotropes Atmen Homepage Homonymie hongi Hoʻoponopono Horizont Horus Hotels Hudson Bay Hügeldorf Hügelstadt Hüter-Bewusstsein Hütergeist Hüter-Geist Hüter-Mem Humanismus Humanistische Psychologie Humanität Humanity Humanity Healing Human Resources Human Resource Management Humboldtsches Bildungsideal Humor Huna Hunab Ku Huna-Gebete Hunger Hypnose Hypomanie Hypostase Hypothese der formgebenden Verursachung Hypothesen Hysterie. Ian MacKenzie I Faraglioni Ibiza Ibn Arabi Ich Ich-Bewusstsein Ich-Ideal Ich-Psychologie IchTour Ich-Verlust Ideale Idealisierung Idealismus Ideen Ideenflüssigkeit Identifikation Identität Identitätsentwicklung Identitätskonflikt Il Faraglione Île de la Pietra Île de Porquerolles Île de Porri Île de Port-Cros Île de Riou Île Sainte-Marguerite Îlot Saint-Feréol Îlot de la Tradelière Île Saint-Honorat Îles Cerbicale Îles du Frioul Île du Levant Îles Lavezzi Île San Ciprianu Îles de Lérins Îles d'Hyères Îles Sanguinaires Il Galli Illumination Illuminismo Îlot de Capense Imagination Imaginative Verfahren Imam Imbolc Improvisation Improvisationsfähigkeit Impulse Impulskontrolle Indien Indik Indischer Ozean Individualismus Individualreise Individuation Informationen Initiation Initiative innen Innenschau Inner Circle innere Bilder Innerer Kreis Inneres Kind Inneres Selbst Insidertipps Inspiration inspirierendes kollektives Hüter-Feld Instinkt integrale Marktwirtschaft Intellekt intelligent Intelligenz Intelligenzminderung Intelligenztest Interaktion interdisziplinär Interesse Intervention Interview Intervision Intimität Intimitätsentwicklung intrinsisch Introjektion Introspektion Introversion Intuition intuitiv interkulturell interkulturelle Kompetenz interkulturelles Lernen Internet Intervention Introspektion Invention Inventur Investigativer Journalismus
Invincible Sun Ionisches Meer Ionosphäre Ireland Irland irreversibel Isaac Casaubon
Isaak Luria Ischia Islam islamisch Island Isola Abbatoggia Isola Asinara Isola
Barca Sconcia Isola Barrettini Isola Budelli Isola Cana Isola Capicciolu Isola
Cappuccini Isola Capraia Isola Caprera Isola Carpa Isola Cavalli Isola Corcelli
Isola dei Cavoli Isola dei Conigli Isola dei Ratti Isola del Campo Isola del
Cavallo Isola del Coltellazzo Isola del Corno Isola della Malva Isola della
Testa Isola delle Bisce Isola delle Rocche Isola dell'Ogliastra Isola di Campi
Isola di Figarolo Isola di Gavi Isola di Mal di Ventre Isola di Mezzo Isola di
Nisida Isola Dino Isola di Quirra Isola di San Pietro Isola di Sant'Antioco
Isola di Santo Stefano Isola Ferraglione Isola Forte a Mare Isola Genio Isola
Giardinelli Isola Grande Isola Il Cretaccio Isola La Chianca Isola La Chiesa
Isola La Presa Isola Maddalena Isola Manna Isola Molara Isola Mortorio Isola
Municca Isola Padiglioni Isola Patron Fiaso Isola Piana Isola Portisco Isola
Proratora Isola Razzoli Isola Rossa Isola Ruia Isola Ruja Isola San Domino
Isola San Macario Isola San Nicola Isola San Stefano Isola Sant'Andrea Isola
Santa Maria Isola Serpentara Isola Soffi Isola Spargi Isola Spargiotto &
Spargiottello Isola Su Cardolinu Isola Su Giudeu Isola Traversa Isolation Isola
Tavolara Isola Tuarredda Isole dei Poveri Isola Del Toro Isola La Vacca Isola
Vivara Isole di Portolucas Isole I Variglioni Isole Le Camere Isole Marmorata
Isole Nibani Isole Pedagni Grandi Isolotti Barrettinelli Isolotti di Cala Lunga
Isolotti Paduleddi Isolotti Stramanari Isolotto dei Pedrami Isolotto d'Ottiolu
Isolotto Rosso Israel Istrien Isuli Lavezzi Italien Italienisch Item. Jacobson
Jadransko More Jahresrad Jakob Böhme Jakob Lorber James H. Austin Teilhard de Jardin Jean Gebser Jenne Jerusalem Jesus Jetzt Jezira Die Seele (jiva) tritt mit der Silbe ha aus und mit der Silbe sa ein. So wird gesagt, dass sie beständig das Mantra hamsa ausspricht. Jnana Job Enlargement Job Enrichment Job Rotation Jochanan ben Sakkai Johannes-Evangelium Johannes Heinrichs Johari-Fenster John Bell Joint Venture Jordanien Journey Into Self Judentum jüdisch Jugend jugendlich Jul Julfest Julia Juliane von Krüdener Jung Jungbrunnen Jungfernfahrt Jungfernflug. Kabarett Kabbalah Kabbalistik Serge Kahili King Kahuna Kahunas Morrnah Simeona Kala Kalifornien Kälte Kampagne Kampf Kanalinseln Lono Ku Kane Kanaloa Po Ao Kanaren Kanarische Inseln Lono Ku Kane Kanaloa Po Ao Kap Kapitalismus Kapitalismuskritik Kaprije Kapverden Kapverdische Inseln Karameer Karasee Karibik Karibische Inseln Karibisches Meer Karin Karl Jaspers Karl Rahner Karmel Karriere Kaspisches Meer Kastrationsangst Kategoriale Diagnostik Kategorie Kate Bush 50 Words For Snow Among Angels Katharer Katharsis katholisch Kattegat Kauai Kausalattribution Keilschrift Keim Keimenergie Keimkraft Keimwachstum Kennenlernen Kensho Kernessenz Kernschemata Key Kinderseele Kino Kirche Kirchengeschichte Klassifikation psychischer Störungen Klarheit Klärung Klassische Konditionierung Klassische Musik Klaustrophobie Kleidung Klient Klienten Klientenzentrierte Psychotherapie Klientin Klientinnen Klima Klinik Klinische Psychologie Know-How Körperwelt Kontemplation kontemplativ kontemplativer Orden Kontinent Koran Körper Körperbewusstsein Körpergefühl Körperschmerz Körperseele Kognitionen Kognitionspsychologie kognitiv Kognitive Dissonanz Kognitive Umstrukturierung Kognitive Verhaltenstherapie Kognitive Verzerrungen Kohärenzgefühl Kollege Kollegin Kollektive Intelligenz Kollektives Unbewusstes Kollektivismus Kollusion Kommentar Kommunikation Kommunikationstraining Kompensation Kompetenzen Kompetenznetzwerk Komplex Kompliment kompliziert komplizierte Persönlichkeit komplizierte Trauer konditionierte Reaktion konditionierter Reiz Konditionierung Konfabulation Konfession
Konfidenzintervall Konflikt Konfronation Konfrontationstherapie Kongruenz
konkret konkrete Kunst Konkretion Konstruktivismus Konsum Konsumkritik Kontakt
Kontaktaufnahme Kontaktbedürfnis Kontaktdaten Kontaktformular
Kontaktmöglichkeit Kontext Kontinente Kontrolle Kontrollüberzeugungen
Konventionen konventionell Konversion Konzentration Konzepte konzeptuelle
Arbeiten Konzert Kooperative Evolution Koordinaten Kopf Kopfschmerzen Kopfstand Korallenmeer Korallensee Korfu Kornkreise Korrelation Korsika Kortex Kos Kosmologie kosmologisch kosmopolitisch Kosmos Kostenerstattungsverfahren Koyaanisqatsi Kraft Kraftorte Kraftquellen Krampf Krankenkasse Krankheit Krankheitsgewinn Kreativität Kreislauf Kreislaufstörungen Kreislaufzusammenbruch Kreta Kreuz Krise des Kapitalismus Kritische Masse Kritische Psychologie Trier Kriya क्रिया Kriya Yoga Kriyas Krka Kroatien Kroatische Inseln Kronenchakra kryptisch Kryptographie KT Lono Ku Kane Kanaloa Po Ao Küche Küste kulinarisch kultiviert Kultur Kulturangebot kulturell Kulturelle Normen Kulturbildung Kulturgenuss Kulturprogramm Kulturpsychologie Kummer Kumupa'a Kunsttherapie Küste Kundalini कुण्डलिनीKundalini-Schlange Kundalini-Yoga Kvarner Bucht KVT Kybalion Kykladen Kymatica. La Grande Bleue Lac des Pises Lachen Lachtherapie Lactantius Lächeln Längengrad Laden Lage Lagos Lagrasse Land und Leute Länder Lampedusa Lampione Langsamkeit Languedoc-Roussillon Lanzarote Laozi La Rotonda Latenzperiode Latenzphase Latium Lavezzi Lazio Leben Lebensatem Lebenserfahrung Lebenserwartung Lebensfreude Lebensgefühl Lebensgeschichte Lebensgestaltung Lebenshälfte Lebenskunst Lebenslage Lebenslauf Lebenslust Lebenspartnerschaft Lebensqualität Lebenssituation Lebensscripts Lebensskripts Lebensstil lebenswert Leere Leerheit Lehre Leib leiblich Leidenschaft Le Isole Egadi Le Isole Eolie Le Isole Tremiti Leistung Leistungsbereitschaft Leistungsfähigkeit Leistungsmotivation Victoria Lemle Beckner Monti Lepini Lerici Lernen Lernen am Modell Lernzielhierarchie Levanzo Li Galli Libido libidinös Licht Peter Licht Lieder vom Ende des Kapitalismus Wir werden siegen - Buch vom Ende des Kapitalismus Lichtfunken Lichtkörper Lichtperiode Lichtstrahl Lichtstreifen Lichtvers Liebe liebenswert Liebesbeziehung Liebeswahn liebevoll Liguria Ligurien Ligurisches Meer Limited Reparenting Michael Linden Lineares Denkmodell Montagne du Lingas Linosa Lipari Liparische Inseln Lissabon Livata live livello del mare Lobbyismus Loge Logen Logik logisch Logos Logotherapie London Lono Ku Kane Kanaloa Po Ao Look to the source / Nānā i ke kumuLoslassen Lösungsmöglichkeiten lösungsorientiert Lösungsorientierung Lou Reed Magic And Loss NYC Man Lounge Music Love Mont Lozère Ludwig Wittgenstein Luft Luftbild Als Luftlinie bezeichnet man die kürzeste Entfernung zweier Punkte in der Landschaft über den direkten Luftweg durch eine Strecke. Luftlinien verlaufen stets parallel zur Erdoberfläche. Bei größeren Entfernungen ist die Kugelgestalt der Erde zu berücksichtigen. In der sphärischen Trigonometrie bewegt man sich dann entlang von Kreisbögen, deren Mittelpunkt der Erdmittelpunkt ist (sog. Großkreise). Bei der Projektion solcher Strecken auf ebene Karten entstehen im Allgemeinen keine Geraden mehr, sondern Kurven, die aber immer noch den kürzesten Abstand zwischen zwei Punkten repräsentieren. In der Geometrie und der Navigation spricht man daher präziser von der Orthodrome statt von einer Luftlinie. Eine Kartenprojektion, bei der Großkreise (und damit die „Luftlinien“ zwischen zwei Punkten) stets als Geraden abgebildet werden, ist die Gnomonische Projektion. Lughnasadh Lux Aeterna Lux Invictus Luzider Traum Lyrik. Macht Machtmissbrauch Machtstreben Madagaskar Madeira Tour de Madeloc männliche Apostel Magersucht Magic Magick Magie Magier Magierin magisch Magische Orte magisches Denken magisches Handeln Mahabharata Ramana Maharshi Mahayana Maimonides Malchut Malerei Mallorca Malta Mana Mana-Fluss Management Managementtraining Manager Managerin Manarola Mandala Manie Manifestation manifester Trauminhalt Manipulation manisch-depressiv Mario Mantese Mantra मन्त्र Mantras Manuskript Mare Mediterraneo Marettimo Marketing Markt Marktführer Marktmacht Marktplatz Marmarameer Marokko Marseille Marsilio Ficino Martin Buber Martin Luther Martinscica Massenerhebung Massenpsychologie maßgeschneidert Matera Matrix Mauerfall Max Planck maya Maya McKinleyville Median Mediation Medien Meditation Mediterranean Sea El Mediterráneo Medium Medizinische Psychologie Meer Meer von Okhotsk Meister Eckhart Mem Memmingen Mens ad mercurium Menschenführung Menschheit menschlich menschliche Güte Menschlichkeit Mentoring Méditerranée Meeresspiegel La Mer Mercurii ad Aesculapium Mercurii ad Aesculapium sermo universalis Mercurii ad Tatium crater sive monas Mercurii ad Tatium de communi Mercurii Ad tatium Filium suum Mercurii ad tatium Filium suum de generatione & impositione silentii. Quod deus Latens simul ac patens est. Mercurii sermo sacer Mercurii Trismegisti clavis ad Tatium Meridian Merkel verkauft Waffen Meru Foundation Mesa Mesopause Mesosphäre Message Messias Metabewusstsein Metaphern Metaphernreise Metropole Michael A. Persinger Michaeli Karin Migräne Missbrauch Misstrauen Mit Einer Stimme Mitarbeiter Mitarbeiterführung Mitarbeitermotivation Mitgefühl Mitglieder Mitgliedschaft Mithras Mitleid Mitte Mittelmeer Mittelwert Mnemotechnik Mobbing Mobilität Modelllernen Modus Möglichkeiten Mohammed Molarotto Monotheismus monotheistisch Mont Mont Aigoual Monte Autore Monte Montecristo Monterosso al Mare Monti Mo'olelo Mount Moral Moralischer Kapitalismus Moralvorstellungen morphic fields morphische Felder morphogenetische Felder Morrnah Simeona Mosel Motiv Motivation Motivationstraining Mountain Top Airport Mount Everest Mudraprayoga Mudras müde Müdigkeit Mund Michael J. Murphy Musik Muskeln Muskelspannung muskulär Muspilli Muster Mut Mysterienkulte Mystica Mystik Mystische Erfahrungen Mystische Erlebnisse Mystische Orte Mystisches Erleben Mystizismus. Nachhallpsychose Nachhaltiges Wirtschaften Nachhaltigkeit Nafs Nähe Naher Osten Nahtoderfahrungen Name Nānā i ke kumu / Look to the source Nanotechnik Nanotechnologie Napoli Naqoyqatsi Narkolepsie Narzissmus narzisstische Persönlichkeitsstörung Nase Nationalparks Natur Naturheilverfahren Naturparks Neapel Nebenmeer Nectar Nektar Neologismen Nepal Nervi Network Netzwerk Neuanfang Neubeginn Neuplatoniker Neuplatonismus Neurasthenie Neuroleptika Neurolinguistisches Programmieren Neuseeland New York City Neurologie Neuroplastizität des Gehirns Neuropsychiatrie Neuropsychologie Neuropsychotherapie Neurose Neurotische Störungen Neurotransmitter Neuseeland New Age New World Newcastle-upon-Tyne Nice Nichts geht verloren von Allem, was ist: die Menschen irren, wenn sie Umwandlung Untergang und Tod nennen niedergeschlagen Niedergeschlagenheit Niederländische Inseln Nihil eorum Quae sunt interitus sed mutationes: Decepti Homines interitum nominant Niklas Luhmann Niklaus von Flüe Nikola Tesla Nikolaus von Kues Nîmes The 9 Intense Experiences Nirvikalpa Samadhi Nirwana Niveau Nizza NLP Nördlicher Ozean Nordamerika Nordatlantik Nordatlantischer Ozean Insel Norderney Nordkalifornien Nordmeer Nordostengland Nordpazifik Nordpazifischer Ozean Ozeanien Nordpolarmeer Nordrhein-Westfalen Nordsee Norm Norma normal Normalität Normalverteilung Normen Norwegische Inseln Norwegisches Meer Nostradamus Nous Nullmeridian Numana Bill Nye. Oberpläne Objekt Objektbeziehung Objektbeziehungstheorie objektiv Objektivität ödipal Ödipuskomplex Ökumene Offenbarung Offenbarungen Mit offenen Karten Ohnmacht ohnmächtig Ohr Ohren Ohrensausen Ökologie Ökologisierung des Kapitalismus Everything is OK The Happy Carriage Okzitanisch olfaktorisch Om Omar Faruk Tekbilek Ὂ μέγα Omega Omnipotenzgefühle online online Dating online Portal Ontologie Operante Konditionierung Operationalisierung Opposition Opus Dei Optimierung Optimismus optimistisch optisch Orangerie Orb Orbit Orchidee Orchideenfach Orden Organische Störungen Organisches Psychosyndrom Orgasmus orgastisch Orgon Orientierung Orientierungsvermögen orphisch Orsigna Ort Ortsmarke Ostchinesisches Meer Ostfeste Ostsee אותOt Otok Ozean Ozeanclub Ozeangefühl Ozeanien Ozeanische Mythologie OzeanParty OzeanSeminare OzeanVoyage Ozon. Pacing Paganismus Palermo Palmarola La Palma Palmen Panarea Panik panisch Pantano Grande Pantelleria Pantheismus pantheistisch Pantheon Paradies paradiesisch Paradiesorte Paradigma Paradigmenwechsel Paranoia paranoid Parapsychologie Pareto-optimal Paris Particles Partikel Partisanen Partnerprogramm Partnerschaft Partnerschaftsprobleme Partnerschaftsqualität Partnersuche Partnerwahl Party passiv-aggressiv Patanjali Patchwork-Familie Patientenrolle Pavor nocturnus Pazifik Pazifischer Ozean Penisneid Persien Persische Mystik Persischer Golf Person Personensuche Personalauswahl Personalberatung Personalentwicklung Personalführung Personalwesen Persönlichkeit Persönlichkeitsakzentuierung Persönlichkeitsentwicklung Persönlichkeitspsychologie Persönlichkeitsstörung Persönlichkeitstypologie Persönlichkeitswachstum Perspektive Perzentil Peter Fenwick Peter Fuchs Pfarrer Pfarrerin Phänomenologie phänomenologisch Phallische Phase Phallussymbol Phantasiereise Pharmaindustrie Pharmalobby
Pharmavertreter Phil Osophical Philosophie Phobie Phobien Photos Photographie Physik Pi Piana di Mezzo Pianosa Pic Piko-Piko Pilot Pilotin Pimander Pin Daniel Pinchbeck 2012: Time for Change Sting David Lynch Ellen Page Paul Stamets Gilberto Gil Shiva Rea Tiokasin
Ghosthorse Michael Dorsey Ganga White Barbara Marx Hubbard Bernard Lietaer
Terence McKenna Michael Coe Curt Collier Maude Barlow Gaspar Pedro Gonzalez
Andre Soares & Lucy Legan Nassim Haramein Mitch Horowitz Michael Jantzen Ken Jordan Kathi von Koerber Joel Kovel Dennis McKenna Donald McPherson Dean Radin John Perry Barlow Richard Register Joe Rogan Douglas Rushkoff DJ Spooky Penny Livingston-Stark John Todd Ryan Wartena Craig Westcott Inger Yancey Maharishi Mahesh Yogi Pineal Gland Pinnwand Pioniergeist Pizzomunno Placebo Placemark Plakate Plan Plananalyse Planet Platon platonische Ideen Platonismus Plattform Nationalpark Plitvicer Seen Po Lono Ku Kane Kanaloa Po Ao po aumakua Gemeinschaft der Hohen Selbste po´ko´i Zauberer pochendes Herz Podcast poem Poemander Poesie Polarmeer Politische Psychologie Polysemie Polytheismus polytheistisch Polytoxikomanie pono Güte Rechtschaffenheit Sittlichkeit Moral Ethik ponopono Ponza Powaqqatsi Pool Pop Portal Porto Portovenere Portugal Positano positive Korrelation Positive Leadership Positive Psychologie positive Wertschätzung/Anerkennung/Zuwendung Post Postkapitalismus potent Potenz Potenzialentfaltung Potenzialentwicklung PPiA Pracchia Praktika Praktikum Prana Pranayama Pranayamaprayoga Pratyahara Pratyaharaprayoga Praxis Predigt Preis der Könige Priester Priesterin primärer Krankheitsgewinn Prioritäten Prisma Proband Probandin Problemaktualisierung Problembewältigung Probleme Problemlagen Procida Prodromalstadium Profession professionell Profil Profitstreben Progressive Muskelrelaxation Projektion projektive Identifizierung projektive Verfahren Prokrastination Prophet Prophetie Prophetin prophetisch Prophezeiung
Protuberanz Provence Psalmen Psi Psychedelische Musik Psychiater Psychiaterin
Psychiatrie Psychiatrische Krankheiten Psychische Krankheiten Psychische
Probleme Psychische Ressourcen Psychische Störungen Psychische Traumatisierungen Psychoanalyse Psychodrama Psychodynamische Theorien Psychologe Psychologie Psychologie der Massen Psychologie des foules Psychometrie Psychopharmaka Psychopharmakotherapie Psychophysiologie Psychose psychotisch psychosozial Psychosomatische Reha Psychosomatische Störungen Psychosynthese Psychotherapeut Psychotherapie Psychotherapie Informationsdienst Psychotherapie-Begleitung Psychotherapie-Nachsorge Psychotherapie-Wartezeit-Überbrückung Psychologische Psychotherapie Psychologischer Psychotherapeut Pula Pulheim Puls Pulsar Puzzle Pymander Pyrenäen Pyrénées-Orientales. Qi Gong Qualität Qualitätsmanagement Qualitätssicherung Quanten Quantencomputer Quantenheilung Quantenmechanik Quantenphysik Quantensprung Quantentheorie Quantum Quantenpsysik Quartile Quartilsabstand Quasar Quelle Quetzlacoatl Schriftrollen von Qumran Quod in solo deo bonum est alibi vero nequaquam Quod summum malum hominibus ignorare deum. Rabbi Akiba Rabbiner Radio Ragnarök Rahima Warren Raja Yoga Randmeer Randomisierung Paul Raskin Rat Rationalisierung Rauhnächte Reaktionsbildung Realitätstest REBT Rechtsfragen Rede des Asklepius an König Ammon Redekunst Redewendungen Referat Reflexion Reframing Regionen Regression Regulation des Selbstwertgefühls Reha Rehabilitation Reha-Nachsorge Recruiting Redensarten Redewendungen Reformation Reformen Regenbogen Regensburg Regierung Register Registrierung reif Reife Reifung Reim Reincarnation reines Bewusstsein reinforcement Reinigung Reinigungsprozesse Reinigungsübungen Reinkarnation Reise Reiseclub Reiseerleben Reisefotografie Reiseideen Reiseleiter Reiseleitertipps Reiseleitung Reisemotive Reisepartnerschaft Reisepartnersuche Reisephilosophie Reisephotographie Reisepoesie Reisepsychologie Reisesimulator Reisestil Reiseunternehmen Reiseveranstalter Reisevideos Reisewelt Reiseziele Reize Reizüberflutung Rekonstruktion Relaxen Reliabilität Religion Religionsphilosophie Religionspsychologie religiös Religiosität Die Renaissance der Menschheit - Über die große Krise unserer Zivilisation und die Geburt eines neuen Zeitalters Repräsentation Repräsentationssystem Repression Residualzustand Resilienz Résistance Ressourcen Ressourcenorientierung RET reversibel Reversion The Revolution Is Love REVT Rezitation Rhein Rheinland-Pfalz Rhetorik Rhodos Riechen Rigveda Rijeka Riomaggiore Rishis Risiko Risikobereitschaft Ritual Rocca Massima Rock Carl Ransom Rogers Rolle Rollenerwartungen Rollenstress Rollenverhalten Rom Roma Roman Romantik romantisch Roquebrun Rorschachtest Rose Rosecrucians Rosenkreuzer Rotes Meer Routenplaner Rtanj Rubrik Ruck Rudolf Insel Rügen Rumi Rumination Runen. Saat Sabbat Sacro Specco Sachbuch Sachkompetenz Sachverzeichnis Sacred Activism Sacred Economics - Money, Gift & Society in the Age of Transition Sacred Geometry Sahaja Yoga Saint-Guilhem-le-Désert Saint-Sauveur-Camprieu Sakarun Salina Salutogenese Samadhi Samadhiyoga Samaveda Samhain Samhitas Samos San Benedetto Santuario della Montagna Spaccata Sardegna Sardinien Satchakrabedha Satori Satsang Saturnalien Schabbat Schalom Scham Schamanismus Schatten Schattenarbeit Schatzsuche Schatztruhe Schechina Schema Therapy Schemaanalyse Schemata Schematherapie schematisch Schicksal Schicksalskräfte Schiff Schiffsreisen Schimon ben Jochai Schiss Schizoaffektive Störung schizoid Schizoide Persönlichkeitsstörung Schizophrenie Schlafstörungen Schlangenkraft Schizophrenie Schizotype Persönlichkeitsstörung Schlaf Schlafphasen Schlafqualität Schlafstörungen Schlagwort Schloss Schlüssel Schlüsselwort Schlussfolgerungen Schmecken Schmerzen Schmiergelder Schnorcheln Schönheit schöpferisch Schöpfung Schottland αἴνιγμα schreiben Schrift Schriftrollen von Qumran Schriftzeichen Schüchternheit Schuldbegriff Schule Schwächen Schwarm Schwarmintelligenz Schwarze Liste der Großkonzerne Schwarzes Meer Schwedische Inseln Schwimmen Schwindelgefühl Schwitzen Scogli de Piscadeddus Scogli del Felce Scogli della Cantina Scogli di Apani Scogli Mortorietto Scoglio del Monacone Scoglio della Colombaia Scoglio di Aniello Antonio Scoglio di Monte Russu Scoglio di Peppino Scoglio di Portonuovo Scoglio Il Morto Scoglio Isca Scoglio L'Agusteri Scoglio Montagnello Scoglio Munichedda Scoglio Pan di Zucchero Scoglio Ravia Scoglio Rosso Scoglio San Martino Scoglio San Stefano Scoglio Su Brecconi Scoglio Vetara Le Scoglitelle Scotland 6.666 6.236 Secret See Seele Seelenlehre Seelenverwandte Seelenwanderungslehre Seelische Gesundheit Segni Sehen Sehnsucht sekundärer Krankheitsgewinn Sekten Selber machen wollen Selbstachtung Selbstaffirmation Selbständigkeit Selbstbestimmung Selbstbewusstsein Selbstbild Selbsteffizienz Selbstentwicklung Selbsterfahrung Selbsterfahrungsreisen Selbsterforschung Selbstergründung Selbsterkenntnis Selbsthilfe Selbstkenntnis Selbstkonzept Selbstmanagement Selbstmord selbstsicher Selbstsicherheit Selbstsicherheitstraining Selbstsystem Selbstunsicherheit Selbstunsichere Persönlichkeitsstörung Selbstvertrauen Selbstverwirklichung Selbstwerdung Selbstwert Selbstwertbestimmung Selbstwerterhöhung Selbstwertgefühl Selbstwertkonzept Selbstwertmanagement Selbstwertmaßstab Selbstwertregulation Selbstwertreisen Selbstwertsteigerung Selbstwertpsychotherapie Selbstwertschatz Selbstwerttraing Selbstwerttherapie Selbstwirksamkeit Selbstwirksamkeitserwartung self efficacy Seligman Martin Seminare Seminarraum Sensiblität Sephiroth Sermoneta Server Sexualität Sexuelle Schwierigkeiten Shalom
, שלום חורים,שלום חורים
! שלום,שלום
, להתרות,להתרות
(2x) ! שלום,שלום
Shalom chaverim, shalom chaverim, shalom, shalom! Lehitraot, lehitraot, shalom,
shalom! Shasta Shatkarmasadhana Rupert Sheldrake Shift of Consciousness Danny Shine Shiva Shodhana Shop Shopping Shruti Shuddhadvaita Šibenik sicher Sicherheit Sichtweise Sid Sieb des Eratostenes Siècle des Lumières Silberstreif am Horizont Simbruini Morrnah Simeona Singlebörse Singlereisen Sinn Sinne Sinnenfreude Sinnerleben Sinngefühl Sinnlichkeit Sirince Sirius Sirolo Situation situativ Sizilien Skagerrak Skype Smartphone Smriti Social Network Social Psychology Soft Skills Soham सोऽहम् Sohar Sol Invictus solar solidarisch Solidarische Moderne Solidarität Solstice Solstitium Somatisierung Sommersonnwende Sonne Sonnenschein Sonnenstrahlen Sonnensturm Sonnensystem Sonnenuhr Sonnenwind Sorgen sozial Soziale Kompetenz Soziale Kontrolle Soziale Normen Soziales Kompetenztraining Soziales Netzwerk Sozialmedizin Sozialpsychologie Soziotherapie Souvenir Space Spaltung Spanien Spanisch
Spanische Inseln Spannung Spaß Spektrum Sperlonga Spirale spiritual activism Spiritualität
spirituell Spirituelle Marktwirtschaft Spiritueller Aktivismus Split Sportpsychologie Sprache Sprachen Sprachenlernen Sprachtraining What In The World Are They Spraying? Why In The World Are They Spraying? Sri Lanka Staatsexamen Stabilität Stadt Stan Tenen Standardabweichung Stärken Stardust stars Statistik Stellenangebote Sterben
Sterne Sternenstaub Steve de Shazer Worte waren ursprünglich Zauber Von der
Problemsprache zur Lösungssprache Steven T. Katz Stille Stimulation Störungen
durch psychotrope Substanzen Stichprobe Stichwort Stichwortregister Stichwortverzeichnis Stille Stiller Ozean Stimmung Stoizismus Stolz Stonehenge Strahlen Strand Stratopause Stratosphäre Streik Stress Stringtheorie Stromboli Studienanfänger Studienanfänerinnen Studienanfang Studienbeginn Studienort Studienreise Studenten Studentinnen Studie Studierende Studium Su Scoglieddu Su Scogliu Mannu Subjekt subjektiv Subiaco Sublimierung Subtropen subtropisch Suchbegriff Suchwort Suchmeldung Sucht Suchtverlagerung Südafrika Südamerika Südatlantik Südatlantischer Ozean Südchinesisches Meer Süden Südeuropa Südfrankreich Süditalien Südlicher Ozean Südmeer Südpazifik Südpazifischer Ozean Südpolarmeer Südsee Sufi Sufismus sufiyya Suggesition Suizid suizidal Summer Sun Sunshine Supernova Supervision Suren Susan O'Kieffe Sustainability Svatmarama Insel Sylt Symbole Symbolisierung Sympathie Synästhesie Synchronictiy Synchronizität Syndrom Synectics Synektik Synergie Synergieeffekte Synergie-Forum Synergiewirkung Synkretismus Synthese Systemische Therapie Systemwandel. Tagesklinik taktil Talent Talmud La Tamarissière Tanztherapie Taoismus Taxonomie Tagesausflug tajalliya Tantra tantrisch Tao Tarif tasawwuf Tasmanisches Meer Tasmanische See Tasmanmeer Tasmansee Tasten Tat Tauchen Eldon Taylor Team team building Teamentwicklung Teamfähigkeit Teamgefühl Teamgeist team spirit Teamwork Technik Technologie Teilhard de Jardin Teilzeit-Ausbildung Telefon Tellaro Teneriffa Terminvereinbarungen Test Testpsychologie Text Textkörper Textur Thanatos The Candle And The Flame Thema Themen Themenzentrierte Interaktion Theorie Theosophie Thermosphäre These Third Eye Thomas-Evangelium Thomas von Aquin Thronvers Tibetanische Klangschalenmeditation Tibetan Singing Bowl Meditation
Tic-Störung Tiefenpsychologie Tiere Tierschutz Tierwelt Tipps Titel Tod Todd J
Sheridan Todestrieb Toleranz Toleranzentwicklung Topographie Topographisches
Modell Tora Torah Toroidal Vortices Tour Tourismus Tourismusforschung
Tourismuspsychologie Tourismussoziologie Tour Operator Tractatus
Logico-Philosophicus Trailer Training Traktate Trance Trancezustand
Trancereisen Trani Tranquilizer Transaktionsanalyse transformierende HauptenergiezentrenTranspersonale Psychologie Transport transsituative Konsistenz Trance Transzendentale Meditation Transzendenz Trauer Traum Trauma Traumarbeit Traumdeutung Traumreise traurig Tree of Life Tree of Patience Treffen Treue Trèves Trèvezel Trieb Triebverzicht Trier Trinidad Bay Trinity Alps Trinity College Trinken Trojaner Tropic of Cancer Tropen tropisch Tropopause Troposphäre T-Shirt Türkei Tugenden Tunesien Tyrrhenisches Meer Neil deGrasse Tyson. Übelkeit Über die Wiedergeburt und das Gebot des Schweigens Überbewusstsein Überdauernde Dispositionen Überdeterminierung Übergänge Über-Ich überschwenglich Übertragung Überwachungsstaat Überweisung 'Uhane Uhr Uhrzeit Umbruch Umschwung Aufruf zum Umsturz Umwälzung Umwandlung Umweltpsychologie Ungeschehen machen wollen Umweltschutz Una Una Finnegan Unbehagen unbehaglich Ungewissheit Unglaubwürdigkeit Unified Field 'Unihipili unio mystica unisex Unity Universität Universitätsclub Unruhe Unruhen unsicher Unsicherheit unsicher-vermeidender Bindungsstil Unterernährung Unterkunft Unternehmung Unterwasserwelt Unterwerfung versus Kontrolle Untersuchungseinheit unwandelbare Urbilder und Muster unzufrieden Unzufriedenheit Upanishaden Urlaub Urlaubertypologie Urlaubsflirt Urlaubsmotive Urlaubsziele USA Insel Usedom Ustica. Validität Variable Varianz Variation Brian Vaszily Vatikan Veda Vedangas Vedanta Veden Vega Charles Veitch Ventotene Veränderung verärgern verärgert Veranstaltungen Veranstaltungsbesuch Veranstaltungskalender Verantwortung
Verantwortungsbewusstsein Verarbeitung Verarbeitungsmodus Verbindung
Verbundenheit Vercors verdeckte Aktion verdeckt Ermittlung verdeckte
Selbstinstruktion verdecktes Verhalten Verdrängung Vereinigte Staaten von
Amerika Vereinigung vererbt vererbte Muster Vererbung Vergeben Vergebung
Vergegenständlichung Vergleichende Psychologie Verhalten Verhaltensexperiment
Verhaltensauffälligkeiten Verhaltensgenetik Verhaltenskonsequenz
Verhaltensmodifikation Verhaltensmuster Verhaltensstörungen Verhaltenstherapie
Verhaltensübung Verheißung Verkehr Verkehrsmittel Verkehrspsychologie
Verkehrung ins Gegenteil Verkrampfung Verleugnung Verlust Vermarktung Vermögen
vermutlich Vermutung Vernazza Verpflichtung Vers Verschiebung Verschwörung
Verschwörungstheorien Versicherungen Versorgung Verstand Verstopfung Verteiler
Verteilungsform Verträglichkeit Vertrauen Verwahrlosung Verwandlung Verzeichnis Verzeihen Verzweiflung Vesuv Vesuvio Vialas Videos Videotelefon Vigilanz Villalago Viparikakarani Vis Vishishta-Advaita Vishishtadvaita-Vedanta Vision Visions of a Sustainable World Visualisierung Vita vita activa vita contemplativa vital VitalaVia Vitalität Vitalseele Vogelperspektive Völlegefühl vollkommene und zeitunabhängige Urbilder und Muster Vollzeit-Ausbildung Vom Denken und Wahrnehmen Vorbehalte Vorbewusstes Vorbilder Vorlesung Vorliebe Vortex Vortex of Change Campaign Vorurteile Vorwissen Vox Populi - Methods of Manipulation - by Megan 'Verb' Kargher featuring interviews with David Icke Max Igan Freeman Jordan Maxwell Dr. George Rhodes Ben Stewart and Charlie Veitch Vulcano Vulkan Vulkanismus. wach Wachheit Wachstum Wachstumsbedürfnis Wachstumsorientierung Wachstumsreisen Wachstumsseele Wachstumstendenz Wanderfisch Wärme Waffenhandel in Deutschland Waffenhandel in Europa Waffenhandel stoppen Wahn Wahrnehmung Wahrnehmungsfilter Wahrnehmunsstörungen Sylvester Walch Wales Wandel Wanderfisch Wanderung warm Warning Warnung Wartezeit Wartezeit-Überbrückung Wasser Wassersport Wattenmeer Alan Watts Wave Weaverville Webautor Webcam Wechsel Weddellmeer Weddellsee Weg Wege der Seele Lehre des Weges 道教 weibliche Apostel Wein weise Weisheit Weiße Rose Weißes Meer Weißlicht Weißmeer Weissagung Weiterbildungsstudiengang Psychologische Psychotherapie Weiterleitungsadressen Ernst-Ulrich von Weizsäcker Welle Wellness Welt WeltApp Weltatlas Welterlebniskarte Weltflugsimulator Weltkarte Weltkulturerbe Weltkulturwunder Weltnaturerbe Weltnaturwunder Weltoffenheit Weltraum Weltreise Weltreisesimulator Weltreligionen Weltseele weltweit Wende Wendekreis des Krebses Wendepunkt Wendung gegen die eigene Person Werbung Werte Wertgefühl Werthaltung Wertorientierung Werteorientierung Wertesystem Wesen wesentlich Westfeste Wetter Widerstand Widerstandsfähigkeit Widerstandskraft Wie wirklich ist die Wirklichkeit? Wiederfinden Wiederfinden-Forum Wiederfinden-Portal Wiedergeburt Wiedersehen Ken Wilber Willenskraft William James Willigis Jäger Wintersonnwende Winter Solstice Wirbel Wirkfaktoren Wirklichkeit Wirklichkeitsebenen Wirksamkeit Wirkung Wirkungsfeld Wirtschaftswachstum Wissen Wissenschaft wissenschaftlich With One Voice Witze Wohnen Wortfront Wunder wunderbar Wunsch Wünsche Würgereflex wütend Wut. Xenophobie. Yajurveda Yerkes-Dodson-Gesetz Yin und Yang Yoga Yoga-Asanas Yogasutra Yogi Bhajan YouTube Yul Yunus Emre. Zadar Zannone Zauber Zauberer Zauberin Zeichen Zeigarnik-Effekt Zeit Zeigeist Zeitmessung Zeitraffer Zen Zen-Buddhismus Zensor zentraler Kulturgedanke Zero Field Energy Zero Point Field Zeugnis Ziel Zielbewusstsein Ziele Zielerreichungsskalierung Ziggy Marley Zirbeldrüse Zirkularität Zitate Zittern Zivilcourage Zohar Zoophobie Zoom ZoomApp Zoomfaktor Zoomwert z-Transformation Zhuangzi Zufall Zufallsexperiment Zufallsprozess Zufallsvorgang Zufriedenheit Zugehörigkeit Zugehörigkeitsgefühl Zukunft Zuneigung Zunge Zusammenbruch Zusammengehörigkeit Zusammengehörigkeitsgefühl Zwangsgedanken Zwangshandlungen Zwangsstörungen Zwänge zweiseitige Hypothese (ungerichtete Hypothese) 2012 Zweitausendzwölf zweite Begegnung zweite Chance zweites Ich Zyklothymie Zyklus Zypern. 2012-2013-adresse abenteuer-adresse achtsamkeitsreisen aerodromedar airstrips aka-demie aka-huna aktionspotentiale all-adresse alpha-adresse alphaaugen alphablick alphaflirt alphagehirnwellen alphalächeln alphamarke alphawavebook alphawaveclub altopiano alumnibund ampel-adresse anti-burnout-adresse aufwiederflirten augenblick-adresse augenblickshirt augenweide-adresse a-und-o-adresse axonhügel. backcountrypilot be-adresse beflügelnd begegnung2 beratung-luftlinie berge-adresse besteorte besuch-adresse bewuss-t bilder-adresse bindestrich-adresse blickadresse blick-adresse blickagent blickagentur blickamt blickauskunft blickback blickbegegnung blickbook blickcheck blickecho blicken2 blickfang-adresse blickforum blick-gps blickkiste blickkontaktdaten blickkoordinaten blickland blickmarke blickmaus blickmonitor blicknnavi blickortsmarke blickpage blickpin blickpinnwand blickprofil blickregister blickresonanz blickseite blickseiten blickshirtblicksi blicksignal blicksuche blicktreffen blickvermittlung blickverzeichnis blickvz blickweb blickzentrale blickzugabe bookfairline buch-adresse. chancen-adresse check-in-adresse coaching-adresse coaching-luftlinie coachingplusreisen communi-t community-adresse contac-t cortexbook cortexclub cortexplanet. deinflussreich deinreisefuehrer dendriten dendritenbaum deutschland-adresse deutschland-blicke deutschlandbund deutschland-lächeln deutschlandmarke diese-adresse dopaminblick dopapin du-adresse durchblick-adresse. earthapp ebautor eine-adresse einheizblick einheizlook einheizshirt empfangs-adresse endorphinblick energie-adresse entspannungs-adresse erholungs-adresse erkenntnisreisen erlebnis-adresse erlebnisatlas erlebnispin ers-t ersticlub erstishirt euphoriepin eupin eurekapool europa-blicke europa-lächeln europassage europa-traumreise exis-t experimental-adresse eyecursor eyes-t. facefairline facelookx fantasie-adresse fantasieflug favoriten-adresse feierabend-adresse fernwehwehchen fernwohl filmreifreisen finde-adresse findehin findepin finderbuch fliblibook fliblibuch flir-t flirtambulanz flirtamt flirtblickbook flirtblickbuch flirtblickshirt flirtchance-verpasst flirtecho flirten2 flirtfairline flirt-gps flirtklinik flirt-kontaktaufnahme flirtkontaktdaten flirt-kontaktdaten flirtkontaktdatenbank flirtkoordinaten flirtluftlinie flirtmarke flirtname flirtnamefinder flirtnamesuche flirtorte flirtortsmarke flirt-pin flirtpinnwand flirtplacebook flirtpuzzle flirtresonanz flirtrettung flirtsensor flirt-verloren flirt-wiederfinden flirt-wiedersehen flirtzugabe flow-adresse fluss-adresse flusskuss forums-adresse foto-adresse foyer-adresse frankreich-traumreise freigeis-t freihei-t freiluft-adresse freizeit-adresse funkenshirt funkensprung-adresse. gast-adresse gedanken-adresse gedankenstrich-adresse geknistert gelegenheit-verpasst gemeinschafts-adresse genuss-adresse geprickelt gespräch2 gesprächs-adresse gesundheit-adresse gesundheits-adresse gipfelluft goldhasebook goldphasebuch gruppenreisen-adresse. haben-oder-sein-book haben-oder-sein-buch happy-end-adresse hasebook heimatvz herzschlag2 heuhaufennadel heureka-adresse hiddenbeach hiddencanyon hiddenlake hier-adresse hinblicke hinfinden hinwollen horizont-adresse humanityshirt humor-adresse. ich-adresse ichplusreisen ideal-adresse ideen-adresse ikoordinaten impuls-adresse in-aller-munde-adresse individualreiseideen innovations-adresse insiderpin inspirations-adresse inter-adresse interesse2 interesse-adresse interne-t italien-traumreise i-t-shirt iyouwebook. jeckbook jetzt-adresse. kennenlern-adresse klickshirt knistershirt koffeinblick kontaktaufnahme-verpasst kontaktpuzzle kontakt-verpasst kraft-adresse kroatien-traumreise kuckbook kult-adresse kunst-adresse. lächelblick lächelfllirt lächelland lächelshirt l-adresse laternen-adresse lebens-adresse lebensfreude-adresse lebensstil-adresse lebenswert-adresse lebenswertreisen lichtseiten-adresse lieblingsortsmarke literatur-adresse lockbook logie-adresse login-adresse logo-adresse lookfairline lookilook lookplacebook luftlinie-adresse. mars-adresse matrix17 matrix-adresse matrixcontact meer-adresse meerestrips meerseeland mensch-adresse merk-adresse mesapienza mesapin mesavola metaphasebook metaphernabc metaphernreise mountaintopairport musenkuss-adresse musik-adresse. nana-i-ke-kumu naturschönheiten-adresse navigationsstern navigavia navilavia neckbook neologistisch net-adresse network-adresse netzwerk-adresse neueorte neugier-adresse neuorientierungsreisen neuronennetzwerk niveau-adresse nordlichtraum. omega-adresse optimal-adresse opusidee opusriot orientierungs-adresse orientierungsreisen ortepforte ortidee ortschatulle ortzauber ortzeitflirt ortzeitname ostlichtraum ozcl ozeanbuch ozeanclub ozeancoaching ozeangefühl ozeanluft ozeanparty ozeanseminare ozeanvoyage. p-adresse panorama-adresse paradies-adresse paradiesorte paradisopin par-t penisola philosophie-adresse philoventura pinballoon pininsel pinirama pinisola pinsextant pintool plateaumesa plateauphase pluli plulivia pluspünktchen ponopono portal-adresse psychologen-luftlinie psychologentipps psychologie-adresse psychologiemetaphern psychologieplusreisen psychologie-positive psychologie-reisen psychologisch-reisen psychotherapeutisch-reisen psychotherapie-reisen pünkt punktplus. quintessenz-adresse. raumzeit-adresse reisegast-adresse reisegefühl reisegoldschmiede reisehinsider reisekoordinaten reiseleitertipps reiselösungen reise-mit-gefühl reise-mit-liebe reise-mit-menschen reise-mit-sinn reisen-adresse reisenähkästchen reiseniveau reisephilosophie reisepin reisepoesie reise-psychologe reise-psychologie reisepsychologie reise-psychotherapeut reise-psychotherapie reise-selbsterfahrung reisesimulator reisesinn reise-therapeut reise-therapie relax-adresse ruhe-adresse. sahneorte schatz-adresse schönheit-adresse schriftsteller-adresse see-adresse seenblick sehen2 selbst-adresse selbstbegegnungsreisen selbst-begegnungs-reisen selbstentdeckungsreisen selbstplusreisen seminar-adresse sensor-adresse serotopin shirt-adresse shirtkontakt shirtmarke singletraumreisen sinn-adresse sinnfindungsreisen sonnenseiten-adresse spaziergang-adresse spiegelsextant sprachbildergalerie start-adresse stimulus-adresse strand-adresse streichelwort studibund südlichtraum sympathie2 sympathie-adresse synapsenspalt synergiewirkung. tagespin tagort text-adresse textballoon therapeutisch-reisen topoesie topoetry topopin toposia topplacebook top-secret-adresse traum-adresse traumkoordinaten traumreiseberater traumreiseleiter traumreiseperlen traumreiseplaner traumreisepsychologe traumreiseroutenplaner traumroutenplaner tremata trier-shirt trinityalps trinityriver trrp. überraschungstüte unicl uniclubtrier unisextant uni-trier-shirt uni-t-shirt unityshirt universal-adresse universitätsclub universityclub unterwegs-adresse urlaub-adresse. v-adresse venus-adresse vergiss-mein-nicht-adresse via-adresse video-adresse vital-adresse vitalavia vitali-t vitaminblick voyager-golden-record. wachstumsreisen wanderfish waswaswas we-adresse webcampsy weckbook wege-adresse wegebook wegweiser-adresse weiterleitungsziel welche-adresse welcome-adresse welluminati welt-adresse weltapp welt-blicke weltenmarke welterlebniskarte weltflugsimulator weltkulturwunder welt-lächeln weltnaturwunder weltorte weltpin weltreisesimulator weltweitwo weltweitwunder welt-weit-wunsch-adresse weltzoom werte-adresse wertemarke wessen-adresse westlichtraum we-t-shirt weyoubook wiederblicken wiederfinden-forum wiederfindenportal wiederfinden-seite wiederflirten wiederseh-adresse wiedersehen-forum wiedersehen-portal wiedersehen-seite wiedersehensportal willhin willkommen-adresse wir-adresse wirkungsfeld wirkungsfeld-adresse wir-shirt wolke-sieben-adresse wonnesonne woorte work-life-balance-adresse world-wide-web-adresse wort-adresse wortsamen wortwoge wunderbareberge wunderblickshirt. you-adresse younisono youniveau youseeland youtopo youwebook youwebooking youwecam youwecom youwelook youwetube youweweb. zauberblickshirt zaubermarke zauberortsmarke zauberpin zauberpinnwand zauberplacebook zeit-adresse ziel-adresse zoomapp zoomaya zoombuch zoomflug zoomwert zufriedenreisen



Ragnarök Muspilli Aya Enigma αἴνιγμα Chiffriermaschine
Dechiffriermaschine ainigma Kryptographie kryptisch κρυπτός γράφειν
Kryptoanalyse Kryptologie Algorithmus Parameter Klartext Geheimtext
Verschlüsselungsalgorithmen Kryptosystem Authentifizierung Integritätsprüfung
Code Codewort Verschlüsselungsmethode Implementierungen Kryptolinguistik
Steganographie Vertraulichkeit Zugriffsschutz Verschlusssache Integrität
Änderungsschutz Authentizität Fälschungsschutz Verbindlichkeit
Nichtabstreitbarkeit Urheber Absender 
Daten Empfänger Transposition Skytale Monoalphabetische Substitution
Polyalphabetische Substitution Caesar-Verschlüsselung Vignère-Verschlüsselung
Transformation Metaphase Mitose Metamorphose Mossad symmetrische Verfahren
asymmetrische Verfahren psychologische Kriegsführung diskrete mathematische
Strukturen Diskretion endliche Körper Ringe eliptische Kurven Gitter Tabelle
Kalkulation Hashfunktionen Ad-hoc-Konstruktionen Bit-Verknüpfungen XOR
Bitfolgen Advanced Encryption Standard Secret-Sharing Stromverschlüsselung
linear rückgekoppelte Schieberegister Register ziehen
Zeichenaustauschalgorithmen Atbasch-Verschlüsselung Alphabetum Kaldeorum
Kerckhoffs‘ Prinzip T52 SZ42 Codeknacker Projekt Ultra Communication Theory of
Secrecy Systems Claude Shannon Informations- und Kommunikationstheorie Nucleus
Kern Zellkern Organell eukaryotischer Zellen ZNS Atomkern Kritische Masse
Zentralnervensystem Silbenkern Sprechfluss Anonymous CIA ανώνυμος
Anonymisierung Nuklearer Operator Nuklearer Raum Spionage Galaxiekern
Betriebssystem Echtzeit Echtzeitbetriebssystem Mikrokernel Chorus OS BND Köder
bait Fliegenrute Spinnrute leichte Pilkrute Karpfenrute Brandungsgeschirr
Blinker Fliegenblinker Jerkbaitrute Pilkrute Schwere Bootsrute dicke
Pilker Naturköder Fliegen geschleppte Wobbler Gummifisch Pilker mit
oder ohne Beifänger Naturköder Reker Würmer Fischfetzen Muscheln Seppioline
Dickfischköder Heringskebap
Flattermakrele Lumbbauch ganze Köhler security by obscurity subliminal DES Data
Encryption Standard maze Labyrinth Newcleus National Security Agency NSA FIPS
46-2 Federal Information Processing Standard 3DES FIPS-197-Standard AES New
Directions in Cryptography Whitfield Diffie Martin Hellmann

 Public-Key-Verfahren Guy Fawkes
Schlüsselaustausch Kommunikationspartner vertrauenswürdiger Kurier
Geteiltschlüssel-Verfahren öffentlicher Schlüssel Schlüsselinhaber privater
Schlüssel Schlüsselpaar digitale Signatur Hashwert GCHQ Government
Communications Headquarter Cheltenham
James Ellis Clifford Cocks Malcolm Williamson SOS Heber für Zwischenboden
homomorphe Verschlüsselung Craig Gentry Cloud-Computing sensible Daten
Faktorisierung faktorisierungsbasierte Public-Key-Kryptographie Tabulator
Primzahlen Primfaktoren Sieb des Eratosthenes

Diskreter Logarithmus Elgamal-Kryptosystem ECC Codierungstheorie algebraische
Funktionenkörper RSA DSA Diffi-Hellmann Elliptic Curve Cryptography
Quantencomputer Polynomialzeit Supercomputer DNA-Computer Recheneinheiten
DNA-Fragmente Phil Zimmermann Pretty Good Privacy PGP Usenet digitale
Unterschrift vertrauenswürdige Behörde

Afrikaans gelukkige verjaarsdag / geseënde verjaarsdag
Albanisch gëzuar ditëlindjen
Arabisch aid milad said
Armenisch tsnounde shnorhavor
Aserbaidschanisch ad gununuz mubarek
Baskisch zorionak zuri
Weißrussisch З днём нараджэння (Z dniom naradzhennia)
Bengalisch subho janmadin
Bosnisch sretan rođendan
Bulgarisch честит рожден ден
Burmesisch mwe nay mingalar pa
Katalanisch feliç aniversari
Chinesisch (Cantonesisch) sang yut fai lok
Chinesisch (Mandarin) sheng ri kuai le
Korsisch felice anniversariu
Kroatisch sretan rodjendan
Tschechisch všechno nejlepši
Dänisch tillykke med fødselsdagen
Niederländisch gefeliciteerd met je verjaardag / gelukkige verjaardag
Esperanto felicxan naskigxtagon
Englisch Happy birthday
Estnisch palju õnne sünnipäevaks
Finnisch hyvää syntymäpäivää
Flämisch gefeliciteerd met je verjaardag
Französisch joyeux anniversaire
Friesisch lokwinske mei dyn jirdei
Deutsch Alles Gute zum Geburtstag oder
Herzlichen Glückwunsch zum
Griechisch na ta ekatostisis / chronia polla / xronia polla
Haitianisch jwayé zanivèsè / bon anivèsè
Hawaianisch hau'oli la hanau
Hebräisch yom huledet sameakh
Hindi janamdin mubarak ho
Ungarisch boldog születésnapot kívánok
Isländisch til hamingju með afmælið
Indonesien selamat ulang tahun
Irisch lá Breithe shona dhuit
Italienisch buon compleanno
Japanisch o tanjôbi omedetô (gozaimasu) (etwas förmlische mit
Koreanisch saeng-eel-chook-hah-hahm-nee-dah
Kurdisch rojbuna te piroz be
Laotisch souksaan van kheud
Latein felix dies natalis / felix sit natalis dies
Lettisch apsveicu dzimšanas dienā
Litauisch su gimtadieniu
Luxemburgisch E schéine Gebuertsdag
Mazedonisch sreken rodenden
Maltesisch xewqat sbieħ għal għeluq sninek
Maori (Neuseeland) ra whanau koa
Mongolisch tursun udriin bayar hurgeye (Tєрсєн єдрийн баяр хvргэе)
Norwegisch gratulerer med dagen
gratulerer med fødselsdagen
Persisch tavallodet mobârak
Polnisch wszystkiego najlepszego z okazji urodzin
Portugiesisch feliz aniversário / parabéns
Rumänisch la mulţi ani
Russisch С днем рождения (S dniom rojdeniya)
Samoanisch ia manuia le aso fanau
Sardinisch bonos annos (logudorese) / bonus annus (campidanese)
Schottisch co-latha breith sona dhuibh
Serbisch srecan rodjendan
Slowakisch veselé narodeniny / všetko najlepšie k narodeninám
Slowenisch vse najboljše
Spanisch feliz cumpleaños
Suaheli kumbukumbu njema [nndjema] / pongezi kwa siku ya
Schwedisch grattis på födelsedagen
Schweizerisch (deutsch) Vöu Glöck zom Gebortstag
Tagalog maligayang kaarawan
Tahitianisch ia ora te mahana fanaura'a
Thai / thailändisch สุขสันต์วันเกิด (souksaan wankeud)
Türkisch dogum gunun kutlu olsun / nice yillara / iyiki dogdun
Udmurtisch vordiśkem nunalenyd
Ukrainisch З днем народження (Z dnem narodzhennya)
Usbekisch tug'ilgan kuningiz muborak bo'lsin
Vietnamesisch chúc mừng sinh nhật
Walisisch penblwydd hapus
1 1 15 Alpheratz 2,07 α And 358 N 29° 97
2 3 99 Ankaa 2,4 α Phe 354 S 42° 77
3 4 168 Schedir 2,24 α Cas 350 N 57° 230
4 5 188 Diphda 2,04 β Cet 349 S 18° 96
5 8 472 Achernar 0,45 α Eri 336 S 57° 144
6 11 617 Hamal 2,01 α Ari 328 N 23° 66
* 9 424 Polaris 1,99 var α UMi 322 N 89° 430
7 * 897 898 Acamar 2,88 θ Eri 316 S 40° 160
8 12 911 Menkar 2,54 α Cet 315 N 04° 220
9 14 1017 Mirfak 1,8 α Per 309 N 50° 590
10 16 1457 Aldebaran 0,86 var α Tau 291 N 17° 65
11 17 1713 Rigel 0,15 var β Ori 281 S 08° 770
12 18 1708 Capella 0,07 α Aur 281 N 46° 42
13 19 1790 Bellatrix 1,64 γ Ori 279 N 06° 240
14 20 1791 Elnath 1,66 β Tau 279 N 29° 130
15 21 1903 Alnilam 1,69 ε Ori 276 S 01° 1300
16 24 2061 Beteigeuze 0,55 var α Ori 271 N 07° 430
17 27 2326 Canopus −0,73 α Car 264 S 53° 310
18 29 2491 Sirius −1,46 α CMa 259 S 17° 9
19 30 2618 Adhara 1,5 ε CMa 255 S 29° 430
20 33 2943 Prokyon 0,36 α CMi 245 N 05° 11
21 34 2990 Pollux 1,14 β Gem 244 N 28° 34
22 35 3307 Avior 1,87 ε1 Car 234 S 60° 630
23 36 3634 Suhail 2,23 λ Vel 223 S 43° 570
24 37 3685 Miaplacidus 1,67 β Car 222 S 70° 113
25 38 3748 Alphard 1,98 α Hya 218 S 09° 180
26 39 3982 Regulus 1,36 α Leo 208 N 12° 78
27 41 4301 Dubhe 1,8 α1 UMa 194 N 62° 124
28 42 4534 Denebola 2,14 β Leo 183 N 15° 36
29 * 4662 Gienah Gurab 2,58 γ Crv 176 S 18° 165
30 43 4730 Acrux 0,79 α1 Cru 173 S 63° 320
31 44 4763 Gacrux 1,63 γ Cru 172 S 57° 88
32 46 4905 Alioth 1,77 ε UMa 167 N 56° 81
33 49 5056 Spica 0,97 α Vir 159 S 11° 260
34 50 5191 Alkaid 1,86 η UMa 153 N 49° 101
35 51 5267 Hadar 0,61 β Cen 149 S 60° 530
36 52 5288 Menkent 2,06 θ Cen 148 S 36° 61
37 53 5340 Arktur −0,05 α Boo 146 N 19° 37
38 54 5459 Alpha Centauri −0,27 α1 Cen 140 S 61° 4
39 56 5530 5531 Zuben-el-dschenubi 2,64 α Lib 137 S 16° 77
40 57 5563 Kochab 2,07 β UMi 137 N 74° 127
41 59 5793 Alphekka 2,22 var α1 CrB 126 N 27° 75
42 61 6134 Antares 0,95 var α Sco 113 S 26° 600
43 62 6217 Atria 1,92 α TrA 108 S 69° 420
44 * 6378 Sabik 2,43 η Oph 103 S 16° 84
45 64 6527 Shaula 1,62 λ Sco 097 S 37° 700
46 65 6556 Ras Alhague 2,08 α Oph 096 N 13° 47
47 67 6705 Etamin 2,24 γ Dra 091 N 52° 148
48 68 6879 Kaus Australis 1,84 ε Sgr 084 S 34° 145
49 69 7001 Wega 0,03 α Lyr 081 N 39° 25
50 70 7121 Nunki 2,05 σ Sgr 076 S 26° 220
51 71 7557 Altair 0,77 α Aql 062 N 09° 17
52 72 7790 Peacock 1,93 α Pav 054 S 57° 180
53 73 7924 Deneb 1,24 α Cyg 050 N 45° 3000
54 75 8308 Enif 2,38 ε Peg 034 N 10° 670
55 76 8425 Al Nair 1,74 α Gru 028 S 47° 101
56 78 8728 Fomalhaut 1,15 α PsA 016 S 30° 25
57 80 8781 Markab 2,49 α Peg 014 N 15° 140

Balsamba, ‘Uhane, ‘Unihipili, Geist eines verstorbenen Verwandten, Aumakua, Ahnengeist, Familienschutzgeist, Kumupa’a, ‘ao’ao, Göttliches Selbst, Überbewusstsein, Inneres Selbst, Höheres Selbst, Huna, Lono Ku Kane Kanaloa Po Ao , Hawaii, Aloha, Ho'oponopono , Ozeanische Mythologie, James Lovelocks Gaia-Hypothese, David Bohm, Ilya Prigogine,David Peat, Rupert Sheldrake, Fritjof Capra, New Age Science, Polynesische Mythologie, Mythologie der Māori, Mana, Esoterik, Hawaiki, Mana, Neuseelandfächerschwanz, Neuseeländischer Kauri-Baum, Kupe, Stammbaum der Gottheiten der Māori, Tainui, Tākitimu, Tiki, Tohunga, Mythologie, Osterinseln, Aku Aku, Hiva, Hotu Matua, Makemake, Moai, Paina-Figur, Haumea, Hiʻiaka, Laka, Lona, Oro, Pele, Rongo, Matariki, Sternbild der Plejaden, Atlantiden, Atlantiaden, Siebengestirn, Sieben Schwestern, Gluckhenne, Sternhaufen, Messier-Katalog M45, Sehungsbogen, heliakischer Aufgang, Alkione, Atlas, Electra, Maia, Merope, Taygeta, Pleione, Celaeno, Asterope, 18 Tau, Nummer nach Flamsteed, scheinbare Helligkeit, Lichtjahre, NGC-Katalog, Reflexionsnebel, Maja-Nebel NGC 1432, Merope-Nebel NGC 1435, Bogenminute, interstellarer Staub, Barnards Merope-Nebel IC 349, kinematisch unabhängig, Höhlen von Lascaux, Auerochse, Sumer, Sterne des Enki, Sterne die dort stehen woher der Ostwind kommt, Astrolab B, bildliches Glyptik-Symbol, Assyrer, Mittani-Zeit, Omentexte, Babylonien, magische Zahl 40, Himmelsscheibe von Nebra, Griechische Mythologie, Nymphen, Dionysos, Zeus, Orion, Subaru, ‏الثريا
Surayya, Soraya Obaid, Satellitentelefonsystem Thuraya,
landwirtschaftliches Kalendergestirn, Beduinen, „Die Plejaden gehen auf über
dürrer Getreidegarbe und unter, wenn das Tal zum Bach wird.“ , „Die Welt kann
wegen der Kälte der Plejaden nur deshalb bestehen, weil der Sirius mit seiner Hitze für Ausgleich sorgt.“, Gezer-Kalender, Flavius Josephus, Laubhüttenfest, Massai, Regenzeitsignalgestirn, Gladys Dickson, Arabische Astrologie, Heliakisch, Geoponica, Indianischer Mythos, Devils Tower, Seven Sisters, Traumzeit, Kreuz des Südens, Menehune, Ui-te-Rangiora, Afrikanische Mythologie , Altorientalische Mythologie, Amerikanische Mythologie, Arktische Mythologie, Baltische Mythologie, Baskische Mythologie, Chinesische Mythologie, Christliche Mythologie, Estnische Mythologie, Etruskische Mythologie, Finnische Mythologie, Germanische Mythologie, Griechische Mythologie, Indische Mythologie, Japanische Mythologie, Jüdische Mythologie, Keltische Mythologie, Koreanische Mythologie, Neopagane Mythologie, Ozeanische Mythologie, Melanesische Mythologie, Mikronesische Mythologie, Römische Mythologie, Slawische Mythologie, Südostasiatische Mythologie, Thrakische Mythologie, Tibetische Mythologie, Türkische Mythologie, Ungarische Mythologie, Xibalbá


in memoriam Una Finnegan, † 19.01.2013, Bidean nam Bian, Glen Coe, Scotland


  • Abece,
  • Abradu,
  • Achido, cp. Shido,
    Jukun: Wukari.
  • Ade,
  • Ae
    , Bade.
  • Agwatana, Baasa of
  • Ahi,
  • 'Aitu,
  • Akötesieti,
  • Akua, see
  • Akuij,
  • Alauna,
  • Alhou, Naga:
  • 'Allah
    (or variations),
    • Arabic
      (Allahu); Arabic, Carahuni, Syriac char. (-Allahu); Arabic:
      Algerian; Arabic: Egyptian (´Allahi); Arabic: Judaeo-Arabic; Arabic:
      Judaeo-Tunisian; Arabic: Mograbi, Arabio char.
      (´Allahu); Arabic; Sudan;
      Arabio: Tunisina Coll. (´Allahi); Arabic: Tunisina Script
      ('AlIaM); Bambara (Alla); Bentuni; Bisaya; Bugis
      (Allataala); Dyak: Land (Allah Taala); (Alatalla) Manyan
      Dyak: Aranyan; Dyak: Ngaju (Hatalla); Dyak; Sea (Allah Taala);
      Eggon (Allah); Pula: Adamawa (Alla); Fula; Futa-Jalon
      ('Allaha); Gang (Alla); Hausa: Arabic roman, and Aljemi char.;
      Jayanese Javanese and roman char. (Allah) Javanese, Arabio char.; Jolof
      (Yalla); Kabyle; Great, Mogrebi char.; Kuranko (Alla); Macassar
      (Alla-taala); Madurese: Jayanese and roman char. (Alla); Malay Baba (Allah); Malay:
      High, Arabic char.; Malay: High, roman char. (Allah); Malay: Low Sasaks
      (AIlah); Malinke (Alla); Maltese (Alla); Mamvu (Ala);
      Mandino roman char. (Alla);
      Mbai: Maisila Sara; Kabba-Laka; Sara Madji-Ngai (Allah); Ngambai
      (Allah) Pashto; Shiha: Central ('Inallah), Shilhla: Northern; Sundanese, Arabic char.; Sundanese. roman char.
      (Allah); Susu; Syriac: Ancient, Estrangelo, Jacobite, and Nestorian
      char.; Syriao; Modern; Turkisih: Gagauzi (Allach); Turkish: Kazan, Arabic
      char.; Turkish Kumuk; Turkish: Nogai; Turkish: Osmanli, Arabic. Greek, and roman
      char.; Turkish; Transcaucasian; Yalunka (Alla); Kulawi (Poee Ala); Mori (Oee
  • Aitjira,
  • Ama,
  • Andriamanitra,
  • Anna,
  • Anoto, see
  • Anute, see
  • Anutu, (or
    • Jabim (Anoto); Kate; (Anute)
      Ragette; (Anut) Amele.
  • Anyambe, see
  • Anyambiè, see Nyambe.
  • Anyambye, see Nyaraibe.
  • Anyame, see Nyambe.
  • Aondo, Munchi
  • A-pa ´Li
    , cp. Lai, Chin:
  • Ap

  • Arnam,
  • Asapavan, Chin:
  • Asdvadz, Armenian:
    Ancient; Armenian: Modern: Eastern; Armenian: Modern:
  • Asila,
  • Atua (or varlations).,
    • Aneityum;
      Aniwa; Epi: Baki; Epi: Bieria; Futuna (Teatua); Gilbert, Islands Hawaii
      (Akua); Maleknia: Aulua, Malekula: Pangkumu; Malekula: Uripiv; Maori;
      Marquesas; Nguna: Efate; Niue; Rarotonga; Samoan; Santo: Nogugu; Santo: Bay;
      Tahiti; Tanna: Kwamara; Tonga
  • Augad, Mabuiag;
  • Ayeba, Ijo:




  • Ba,
  • Banara, Bambatana; VeIIa:
  • Bao,
  • Bali,
  • Bari,
  • Bhagawän
    (or variations),
    • Bhili: Central (Bhogawan);
      Bhili: Dehwali (Bohganä); Bhili: Valvi; Chhattisgarhi; Kurku; Panjabi;
  • Blei,
  • Bog (or variatione),
    • Bulgarian; Polish (Bog);
      Russian; White Russian; Serbian (Bogu); Slavomo; Slovenian; Sloveniaii:
      Hungaro; Ukramian; Wend: Lower; Wend: Upper.
  • Boh, cp. Buh,
  • Boi

  • Bondieu (or variaiwns),
  • Borgan, Mongolian:
  • Borhan, Literary
  • Bozymy, Ukrainian,
  • Buh, cp. Boh,
  • Burchanda, Mongolian:
  • Bok





  • Chihowa, cp
    Jehovah, Choctaw.
  • Chineke, cp. Tsineke,
    Ibo: Union.
  • Chios, see
  • Chiuta, Nyasa; Tonga;
  • Ciong-Di. cp.
    Shang-ti, Chinese: Kienning,
  • Cod, see
  • Cuku, Ibo; lsuama
    (Tsuku); Ibo: Upper.




  • Dagwi,
  • Dagwonom,
  • Davleske, see
  • De
    , cp. Deus, Epi: Lewo;
    Epi: Tasiko.
  • Debata, see
  • Dede
    , Baya:
  • Deewe, see
  • Deis, see
  • Del, see Devel.
  • Den-did,
  • Deu, see Dieu.
  • Deus, Indo-Portuguese
    (Deos); Latin; Portuguese; Portuguese: Brazilian; Romansch: Lower
    Engadine (Deis); Romansch: Oberland; Sardinian.
  • Deva (or
    • Batta:
      AngkoIa-Mandailing, roman char. (Debata); Batta: Toba, Batta and roman
      char. (Debata); Gondi: Koi, roman char. (Dévuni); Gondi; Koi,Telugu char.
      (Devudu); Kanarese, Kanarese (Devaru), Kanarese Badaga
      (Devaru); Malayalam (Devam); Marathi, roman char. (Dewá);
      Marathi, Balbodh char. (Dewa); Marathi: Konkani, Kanarese char.
      (Deva); Marathi: Konkani, roman char. (Devac); Pali (Dewa);
      Sangir (Ruata); Tamil, roman char. (Tevanudaiya); Tamil, Tamil
      (Devan); Telugu (Devadu); Tulu
      (Dever).(Naibata), Batta Simalungen.
  • Devac, see
  • Devel, Romani: Bulgarian C.
    (Devléskere), Romani: Bulgarian SE. (Davléske);
    • Romani: N. German
      (Del i Luma); Romani; S. German; Romani: Lettisih (Devel); Romani:
      Moravian; Romani: Spaniah (Undebél); Romam Yugoslav
  • Dever, see
  • Deviyanwahansay,
  • DevIéskere, see
  • Devuni, see
  • Dia, see Dieu.
  • Dieu (or
    • Carib
      (Bondiu); Catalan (Deu); Dominica (Bon Dié); French; Gaelic
      (Dia); Irish (Dia); Italian (Iddio); Latgalian (Diws);
      Lettish, Gothic char. (Deews), roman char. (Dievs);
      Lithuanian, Gothic char. (Diews), roman char. (Dievas); Mauritius
      Creole (Bondie); Piedmontese (Iddiou); Provencal; Romanseh, Upper
      Engadine; Samogit (Diewas); Vaudois
  • Dievs (or variations),
    • Dio, see
  • Dios, (or
    • Aymara (Diosaji); Bicol;
      Cakchiquel Corsican (Dio); Esperanto (Dio) Ibanag; Igorot: Bontoc
      (Chios) IIocano; Judaeo-Spanish; Lengua Mataco; Maya (Dioz);
      Mexican; Pampangan; Pangasinan; Quechua: Bolivian; Quechua: Ecuadorean; Quochua:
      Huanuco; Quiche; Spanish; Tagalog; Toba; Visayan: Cebuan; Visayan: Panayan;
      Visayan: Samareno.
  • Dioz, see
  • Dirava,
  • Diws, cp. Dieu,
  • Dkon-mchhog
    • Ladakhi (Dkon-mjog);
      Lahuli: Bunan (Kon-chhog); Lahuli: Tinan (Kon-chog);
  • Dok,
  • Doue, cp. Dieu,
    Breton: Léon.
  • Droué,
  • Dú c Chúa Trò
  • Dú c Chuo
  • Dumnedelu,
    cp. Dumnelau,
  • Duninezeu, cp.
    Dumnedelu, Rumanian.
  • Duw, cp. Dieu,




  • Eaubada, Bwaidoga; Daui;
    Dobu; Kiriwina; Tavara; Tubetube.
  • Edeke,
  • Efile
    , Luba;
  • Eloba,
  • Elohim, Arabic: Mogrebi,
    Hebrew .char.; Hebrew.
  • Eloi,
  • Eng'Ai, cp. Ngai,




  • Foy,




  • Gado, see God.
  • Gaddel, see
  • Gaddell,
  • Gedepo,
  • G´mert´man, Georgian,
    civil char.; Georgian, Ecclesiastical char. (G´t´n).
  • Gnalltaeh, Nicobarese:
  • God (or variations),
    • Bamu; Binandere; Binandere:
      Notu; Bugotu; Danish (Gud); Dieri (Goda); Dutch; Dutch Afrikaaas;
      English; Epi: Lewo (God, De), Epi: Tasiko (De, God); Epi:
      Tasiko-Lewo; Eskimo: Greenland (Gutip); Eskimo; Labrador (Gudib);
      mo W. (Godim); Eskimo: Mackenzie
      River (Godimli); Fanting (Cod); Flemish; Florida Island; Frisian;
      German (Gott); German: Low German (Gott); Gogodala; Guadalcanar:
      Vaturanga; Icelandic (Gud); Kiwai; Kunini; Kusaie; Kwagutl; Mabuiag;
      Malekula; Ahamb; Malekula: Kuliviu Malo (Cod); Mortlock (Kot);
      Moskito; Mofa; Mukawa; Mwala: Fiu; Mwala: Kwara'ae; Mwala: Lau; Mwala: Malu;
      Mwala; Saa; Negro-English (Gado); Norwegian (Gud); Nungyubuyu;
      Opa: Nduindui (iGod); Raga; San Cristoval: Anganiwei; San Cristoval;
      Arosi; San Cristoval: Tawarafa; Santo: Tasiriki; Swedish (Gud); Tanna:
      Eastern (Kot); Ubir; Ulawa; Wedau; Worrora; Yahgan; Yiddish (Got);
      Eskimo: W. Arctic (Godim).
  • Goda, see
  • Godau, see
  • Godimli, see
  • Gosanyith,
  • Gospod, Perm; Ziryen,
    Slavonic char.
  • Got,
  • Gott, see God
  • Goyakalu,
  • Gud, see
  • Gudib, see
  • Gutip, see




  • Hananim,
  • Harihu,
  • Hatalla, cp.
    Allah, Dyak: Ngaju.
  • Hera, Naga:
  • Hinegbau,
  • Hudha, see
  • Hyel,




  • Ibmell, cp.
    Jupmel, Norwegian Lapp.
  • Iddio,
    , see
  • Iehova, see
  • Ietar, see
  • lgziabiheir, Amharic;
    Ethiopic; Tigrinya.
  • Iju,
  • Ikk, cp. Shekko,
    Kunama; Nubian: Kunuzi (Ikkegon).
  • Ilahey, cp. Allah,
    Somali: Oeaden-Harti.
    Imana, Hangaza; Ruanda;
  • Immlja, Russian
  • Inallah, see
  • Inan,
  • Inmar,
  • Iricouci,
  • Iruva, cp. Ruva,
    Chaga Machame.
  • Ishor, see I´shwar.
  • Ishshor, see
  • I´shwar (or variations,
    see also Parameshwar),
    • Abor Miri (Ishor);
      Assamese; Bagheli; Bengali: Bengali char., and Bengali Colloquial
      (Ishshor); Bengali, Roman char.; Bhatneri; Bihari: Bhojpuri; Bihari:
      Magahi; Biliari: Nagpuria. Kaithi char.; Bikaneri Bodo; Boroni (Ishor);
      Dimasa (Ishor); Garhwali: Tehri; Garo: Achik, Bengali char.
      (Ishal), roman char. (Isol); Gondi: Chhindwara; Gondi: Mandla;
      Gujarati Harauti; Hindi; Ho; Jaunsari; Kanauji; Kanauri; Kashmiri; Kumaoni;
      Malvi; Manipuri; Marwari Nepali; Palpa; Panjabi: Dogri; Rabha: Rangdania;
      Sanskrit Santali (Isor).
  • Isol, see I´shwar.
  • Isor, see I´shwar.
  • Isten,
  • Izuwa,




  • Jainkoak, Basque:
    Labourdin; Basque: Guipuzcoan (Jaungoico-ac); Basque: ftouletm
  • Janahary, Malagasy:
  • Jee,
  • Jehovah (or variations),
    • Choctaw (Chihowa); Karen:
      Bghai, Pwo and Sgaw, Ywa; Kipsigis (Jehoba); Kiwai: Goaribari
      (lehova); Manus Island (Jehovah); Mohawk (Yehovah); Naga.:
      Angami (Jihovaá); Naga: Konyak (Jihovae); Naga: Mao; Nandi;
      'Narrinyeri; Panaieti (Jehova); Santo: Hog Harbour
  • Jen,
    cp. Jinn, Ziryen, Russian
  • Jincouac, see
  • Jing-ming, Chinese,
  • Jiptilal,
  • Jiwheyewhe,
  • Juon,
  • Juma, see
  • Jumala (or variations).
    • Estonian:
      Dorpat (Jummal); Estonian: Reval (Jumal); Estonian: Setu
      (Jummal); Finnish; Karel; Livonian: Eastern (Jumahlto); Mongolian:
  • Jummal, see
  • Jupmel, cp. Ibmel,
    and Jumala, Swedish Läpp.
  • Jwok,




  • Kalona, Nuba:
  • Kalou, Fiji; New Britain;
    Omo; Patpatar.
  • Kalaga,
  • Kalunga, Kuanyama;
    Luimbi, Ndonga.
  • Kami, cp. Kamui,
  • Kamisama,
  • Kamui, cp. Kami,
  • Kanu,
  • Karai
    , Atsi; S.
  • Katonda, Ganda:
  • Khaien, Turkish:
  • Khazopa-ta,
  • Khong,
  • Khuda (or variations),
    • Balochic roman and Arabic char.
      (Hudha); Balti; Bengali: Musalmani (Khoda); Brahui, Arabio and
      roman char.; Dakhini: Arabia and Persian char.; Persian and Judaeo-Persian;
      Kachchhi; Kashmiri, Persian char.; Khasi, Bengali char. (Hadayun);
      Kurdish: Kermanshahi; Kurdish: Kurmanji (Khoda); Kurdish: Mukri; Lahnda.,
      Persian char.; Lahnda: Hindko; Panjabi: Musalmani, Persian and roman char.;
      Shina; Gurezi; Sindhi: Devanagari char. and MusaImani; Tamil, Arabic char.;
      Turkish: Kashgar; Turkish: Kazan, Russian char.; Turkish: Kirghiz, Eastern:
      Russian char. (Khudadin) and Arabic char.; Turkish: Kirghiz, Western:
      Russian char. and Arabic char. (Khudai); Turkish: Uzbek; Urdu:
      Devanagari, Arabic, and Persian char.
  • Khutzau, cp.
    Khuda, Ossete; Turkish: Bashkir (Khozai).
  • Kibumba,
  • Kinikhawma, Chin:
  • Kishemanito, cp.
    Muneto, Chippewa.
  • Kon-chhog, cp.
    Kon-chog, see
  • Kot, see God.
  • Kowe,
  • Kunzi,
  • Kurmam, Jukun:
  • Kuru, Rukuba;
  • Kwama,
  • Kwani, Nanjeri.
  • Kwoth, Nuer (Western); Nuer (Eastern).
  • Kyaik, Talaing.




  • Lago,
  • Leza (or variations),
    • Bemba (Lesa), lla.; Lamba
      (Lesa); Luba: Kaone (Lesa); Luba: Katanga; Mambwe-Lungu; Mukuni;
      Namwanga; Tonga of Zambezi.
  • Loba,
  • Lowalangi,
  • Lu,
  • Lubana,




  • Madaru,
  • Manetualain,
  • Masin, Mundang.
  • Mawu, Ewe; Popo.
  • Maxam,
  • Mbongo,
  • Mbori,
  • Messiner,Tamachek of
  • Mlimu, cp. Modimo, Tabele (umLimu).
  • Mluku, see
  • MIungu, see
  • Mngu, see Mungu.
  • Modimo (or variations).
    • Chuana, Kololo (Mulimo); Pedi;
      Suto (Molimo); Tabele (umLimu).
  • Molimo, see
  • Mudzimu, cp.
    Modimo, Venda.
  • Mughkhai, Nega:
  • Mukuru,
  • Mulmio, see
  • Mulungu (or variations),
    • cp. Mungu, Asu
      (Murungu); Giryama; Gogo (Mulungu u Mulungulungu); Kaguru; Makua
      (Mluku); Mambwe; Manda (Mlungu); Meru (Mulungu); Mpoto
      (Mlungu); Nsenga; Nyamwezi: Nyania: East (Mlungu); Nyika: Nyasa;
      Nyika: Rabat; Nyika: Ribe (Mulunguo); Sena; ShambaIa; Sukuma; Taita:
      Dabida (Mlungu); Taita: Sagalla (Mlungu); Yao; Zigula
  • Muneto, Cree:
  • Mungu, cp. Mulungu
    (or variations),
    • Bira; Bondei (Muungu); Fuliro;
      Hunde; Kele: Congo; Lendu; Lugbara (Munguni); Lur; Ndandi; Pokomo
      (Muungu); Shamba; Swahili: Ngwana; Swahili: Union Ngwana (Mungo);
      Swahili: Mombasa, roman and Arabic char. (Mngu); Swahili; Zanzibar, roman
      and Arabic char.; Union Swahili; Ngwaaa; Lualaba; Peri
  • Munguni, see
  • Muningu,
  • Muungu, see
  • Mwari, Ndau; Sliona; Shona:




  • Naawuni,
  • Nagha
  • Naibata, see.
  • Nalic, cp.
    Nhialic, Jieng: “White Nile.
  • Namanga,
  • Nan, cp. Nen,
  • Nandeyara, see
  • Nara, Duke of York
  • Ncenibi, cp.
    Nyambe, Kuba; Inkongo.
  • Ndzimu, cp.
    Modimo, Kalana.
  • Nen, cp. Nan,
  • Ngai, Kamba; Kikuyu;
    Masai (eng´Ai); Tharaka.
  • Ngewo, Mende: italic and
    roman char.
  • Nguluvi,
  • Ngünechen,
  • Nhialic, cp.
    Nalic, Jieng: Bor; Jieng: Chich (Nialic).
  • Nicscam, Micmac, phon.
    char.; Micmac, roman char. (Nikskam).
  • Nilo,
  • Niotsi, Slave, syllabic
    and roman char.
  • Njambe, see
  • Njambi, see
  • Njambyé, see
  • Nkulunkulu
    , see also
    Sikwembu, Zulu; Chopi.
  • Nöbü,
  • Nom,
  • Nörin, Nubian:
  • Nsambi, see
  • Nükskam, cp.
    Nikskam, Maliseet.
  • Nuleso, Bari
  • Nun,
  • Nungungulu, cp.
    Nkunlunkulu, Tonga of Inhambane; Tswa.
  • Nyaka,
  • Nyam, cp. Nyambe,
  • Nyambe (or variations).
    • Bobangi Adjukru (Nyani);
      Agni (Nyamiapblli); Basa of Cameroon; (Nzambe); Benga
      (Anyambe); Bo Bulu (Zamb');Bungili (Nzambi); Chokwe
      (Zambi); Fang of Gabun (Anyame); Gimbunda; Kakwo Congo
      (Nzambe); Ikota (Nzambe); Kele of Gabun (Anyambie); Kele;
      Kituba (Nzambi); Kiyaka (Nzambi); Ntomba; Kongo: Buende
      (Nzambi); Kongo: San Salvador (Nzambi); Kuba: Luna Inkongo (Ncembi);
      Kwese (Nzambi); Logo (Nzambe); Luba; Lulua (Nzambi); Luba:
      Songi (Nsambi); Luchazi (Njambi); Lumbu (Nzambi); Lunda of
      Kalunda (Nzambi); Lunda of Kambove (Nzambi); Mbunda
      (Njambi); Mbundu of Loanda (Nzambi); Ngala (Nzambe); Ngombe
      (Njambe); Nkoya (Nyambi); Nkutu. (Nzambe); Okela
      (Ndjambi); Omyènè: Galwa (Anyambiè); Ongom (Njambyé);
      Pende (Nzambi); Sakata (Nzambi); Wongo (Nzambi); Yaka
  • Nyamiapbili, see
  • Nyamuhauga, cp.
    Namanga, Konjo.
  • Nyankupon, cp.
    Onyankopon, Ashanti: Fanti.
  • Nyasaye, Hanga; Kisii;
  • Nyesoa, cp.
    Nyasaye, Grebo; Kroo.
  • Nyinyi,
  • Nyonmo,
  • Nzakómba, Eleku; Mongo;
    Mongo: Nkundu.
  • Nzambe, see
  • Nzambi, see
  • Nzame, cp. Nyambe,
    Fang of Ogowe.
  • Nzapa, Banu; Baya; Gbea;
  • Nzua,
  • Nzyambi, see




  • Ocho or Ojo, Agatu
  • Oee
    , see
  • Oghene, Isoko;
  • Oiseleburua,
  • OIorun,
  • Onyankopon, cp.
    Nyankupon, Ashanti: Twi.
  • Osanobua,
  • Oi
  • Otuà, cp. Atua,
  • Ouone, Karre;
  • Owo,
  • Owo-richo,
  • Owuse
    , cp. Chineke and
    Owuso, Ibo: Lower.
  • Owuso, Arago




  • Pachacamackca, Quechua:
  • Pachia, Chin:
  • Pai, Chin: Ngawn.
  • Palagu, Keapara,
  • Parameshwar (or
    variations, cp. I´shwar),
    • Bihari: Nagpuria, Devanagari
      char.; Garhwali; Srinagaria; Garhwali; Tehri (Parmesur); Kulu; Lahuli:
      Manchad (Parmeswar); Mundari, Devanagari and Oriya char.
      (Parameswar); Oriya (Parameswar); Sanskrit, Oriva char.
  • Paramushreela, cp.
    Parameshwar, Khondi.
  • Pa-ra-pyin-zowk,Taungthu,
    Burmese char.
  • Pathennin, cp.
    Pathian, Biete; Chin; Northern; Thado-Kuki.
  • Pathian, Chin: Lai and
    Laizo; Thado: Vaiphei; Lushai; Paite.
  • Pathien, cp.
    Pathian, Gangte Hmar.
  • Päy-yah-the-kin,
  • Paz, Mordoff:
  • Peku
  • Penu,
  • Perendia, Albanian: Union;
    Albanian: Gheg; Albanian: Tosk.
  • Phra, Singpho; Rinng Lang
  • Phtha, Coptic:
  • Potsona, Naga
  • Prajow,
  • P'ra

  • Progru,
  • Pwa,




  • Rabbi, Kabyle,
  • Rabbi
    , cp. Rebbi, Shilha:
  • Rabi,
  • Rebbi, cp. Rabbi,
    Kabyle, Great.
  • Riniwa, Nuba:
  • Ruata, cp. Deva,
    Sangir: Siaow.
  • Ruba,
  • Ruhanga, Nkole;
  • Rüm,
  • Ruva, cp. Iruva,
    Chaga: Moohi.




  • Saghalie
  • Saka-Ntanga,
  • Sang-di, see
  • Säthaw,
  • Schkais. Mordoff:
  • Shàng
    , see Shang-ti.
  • Shang-ti (or variations),
    • Chinese Amoy (Siong-tè);
      Chinese: Canton (Sheung-Tai); Chinese: Foochow (Siong-Dá);
      Chinese: Hainan (Siag`-di); Chinese: Hakka (Son`-ti`); Chinese:
      Hakka: Wukingfu (Shòng-ti); Chinese: Kienning (Ciong-Di); Chinese:
      Kienyang (Shiòng-Doi): Chinese: Peking (Shàng Di);Chinese: Swatow
      (Siang-ti); Chinese: Taichow (Zong-ti); Chinese: Tingchow
      (Shong-ti); Chinese: Wenchow (Zie-ti); Chungchia
  • Shanung-itlagadas,
  • Shashe, cp.
    Tswashe, Gbari; Yamma: Paiko.
  • Shekko, cp. Ikk´,
    Gbari: Gyengyen.
  • Sheung-Tai, see
  • Shiang
    , cp. Shang-ti, Chin:
  • Shido cp. Achido,
    Jukun: Donga,
  • Shiòng-Dói, see
  • Shòngti, see
  • Siag-di, see
  • Siang-di, see
  • Sibu,
  • Sidja, Shan
  • Sikwembu, Ronga
    (Sikwembu Nkulukumba); Thonga.
  • Siong-Dá, see
  • Siong-tè,
  • Sirama,
  • So, Bava:
  • Sòkó,
  • Son`-ti`, see
  • Suandaran,
  • Sujeh,
  • Suku, Mbundu of
  • Sunahan,
  • Sunggigüle, Naga:
  • Supe,
  • Swami,




  • Taikamanoea,
  • Tamasa, Marovo (Tania
    ; Roviana.
  • Tameuh, Chin
  • Tanara, Turkish:
  • Tanbei,
  • Teatua, cp. Atua,
  • Tev, cp. Deva,
    Nicobarese: Car.
  • Tevanudaiya, cp.
    Deva, Tamil.
  • Thedä, Mawken.
  • Theos,
  • Thilu, Nuha:
  • Thixo,
  • Tho (Shiang
    , Chin:
  • Tingrangpui, Naga: Mzieme;
    Naga: Sangtam (Tsingrang).
  • Toepoe,
  • Tororut,
  • Toruimuinne,
  • Torym, cp.
    Toruimuinne, Ostiak.
  • Tsen,
  • Tsineke, cp.
    Chineke, Ibo: Lower,
  • Tsingrang, Naga
  • Tsosa.
  • Tsúku, cp. Cuku,
    Ibo: Isuama.
  • Tsungreme, Naga;
  • Tswashe, cp.
    Shashe, Gbari: Yamma: Gayegi.
  • Tumpa, Guarani:
  • Tupa
  • Tupan,
  • Tyee, see Saghalie
    , Chinook.




  • Ualare,
  • umLimu, cp.
    Molimo, Tabele.
  • Undebél, cp. Devel,
    .Romani: Spanish.




  • Usula,
  • uThixo, see




  • Varivarana, Naga:
  • Ven,
  • Vittekwichanchyo,




  • Wacinaci,
  • Wagayo, Galla:
  • Wagayon, Galla:
  • Wain, Galla:
  • Wakantanka,
  • Waqa.
  • Waqake, Galla: Eastern
  • Wedenga,
  • Were,
  • Wonyingi, Ijo:
  • Wuhgin, Tanna




  • Yakomba,
  • Yalla, cp. Allah,
  • Yamba (Yam), Tangale; Waja; Wurkum.
  • Yatala,
  • Yau, Mandingo: Gambia.
    Arabic char.
  • Yehovah, see
  • Yetar, Santo: Hog
  • Yumui, cp. Jumala,
  • Zamb´, cp. Nzambe,
  • Zambi, see
  • Zapallay-Churinta,
    Quechua; Peruvian.
  • Zie-ti, cp.
    Shang-ti, Chinese: Wenchow.
  • Zo,
  • Zong-ti, cp.
    Shang-ti, Chinese: Taichow.

Abenaqui - Olakamigenoka
Afrikaans Dutch - Vrede
Alabama - Ittimokla
Albanian - La Paqe
Algonquin - Wâki Ijiwebis-I
Amharic - Írq
Arabic - Salam
Aranés - La Patz
Armenian - Khanhaghutyun
Basque - Bake
Bemba - Mutenden
Bengali - Shanti
Blackfoot - Innaihtsi'iyi
Bosnian - Mír
Bulgarian - Mír
Byelorussian - Mír
Carolinian - Gúnnammwey
Catalán - La Pau
Chewa - Mtendere
Chinese - Pingan
Choctaw - Achukma
Chuuk - Kunammwey
Comanche - Tsumukikatu
Cree - Wetaskiwin
Croatian - Mír
Czech - Mír
Danish - Fred
Dari, Persian - Solh
Duala - Musango
Dutch - Vrede
Ekari - Muka-muka
Esperanto - Paco
Estonian - Rahu
Fanagolo - Kutula
Farsi - Ashtee
Filipino - Kapayapaan
French - La Paix
Galician - A Paz
German - Der Frieden
Gikuyu - Thayu
Greek - Iri'ni
Gujarati - Shanti
Haitian Creole - Lapé
Hausa - Lùmana
Hawaiian - Maluhia
Hebrew - Shalom
Hindi - Shanti
Hmong - Kev Thajyeeb Nyab Xeeb
Hungarian - Béke
Igbo - Udo
Indonesian - Damai
Japanese - Heiwa
Javanese - Rukun
Kékchí - Tuktuquil Usilal
ka Inuktitut - Tutkiun
Kannada - Shanti
Khmer - Soksang
Koasati - Ilifayka
Korean - Pyong'hwa
Kurdish - Hasîtî
Lakhota - Wolakota
Lao - 'Kwam Sa
Latin - Pax
Latvian - Miers
Magindanaon - Kalilíntad
Malay - Aman
Malgache - Fandriampahalemana
Maltese - Paçi
Maori - Rangima'arie
Mapudungun - Uvchin
Maranao - Diakatra
Maya - Ets'a'an Olal
Micmac - Wôntôkóde
Miskito - Kupia Kumi Laka
Mongo-Nkundu - Boóto
Navajo - K'é
Nepali - Saanti
Nez Perce - 'Éyewi
Nhengatu - Tecócatú
NW AK Inupiat Inuktitut - Kiñuiñak
Norwegian - Fred
Ntomba - Nye
Nyanja - Mtendere
Palauan - Búdech
Pali - Nirudho
Papago/Pima - Dodolimdag
Pashto - Amniat
Pig Latin - Eace-pay
Polish - Pokój
Ponapean - Meleilei
Portuguese - A Paz
Quechua - Sonqo Tiaykuy
Rapanui - Kiba-kiba
Romanian - La Pace
Ruanda - Nimuhóre
Russian - Mír
Sa'a - Däilama
Samoan - Filemu
Scots Gaelic - Fois
Serbian - Mír
Sesotho - Khotso
Setswana - Kagiso
Sioux - Wo'okeyeh
Slovak - Pokój
Slovene -
Mír Somali - Nabad -Da
Spanish - La Paz
Swahili - Amaní
Swedish - Fred
Tagalog - Kapayapaan
Tahitian - Hau
Tamil - Amaithi
Telugu - Shanti
Thai - Santipap
Turkish - Sulh
Turkish - Barish
Twi-Akan - Asomdwee
Uighur - Saq
Ukrainian - Mír
Urdu - Aman
Welsh - Hedd
Wintu - Mina
Xhosa - Uxolo
Yiddish - Sholim
Yoruba - Alaáfía
Yue - Sai Gaai Òh Pìhng
Zapoteco - Layéni
Zulu - Ukuthula

Arabisch = Ana hebbek
Äthiopisch = Afgreki'
Bengalisch = Aami tomaake bhaalo baashi
Bosnisch = Volim te
Brasilianisch = Eu te amo
Bulgarisch = Obicham te
Chinesisch (Mandarin) = Wo ai ni
Dänisch = Jeg elsker dig
Deutsch = ich liebe dich
Englisch = I love you Esperanto = Mi amas vin
Estonisch = Mina armastan sind
Farsi (Persisch) = Tora dost daram
Finnisch = Minä rakastan sinua
Französisch = Je t'aime
Gällisch (Irland) = Tá grá agam ort
Georgisch = Me shen miqvarhar
Griechisch = S'ayapo
Grönlädisch = Asavakit
Hawaiinisch = Asavakit
Hebräisch = Anee ohev otakh
Hindi = Mai tumase pyar karata hun
Holländisch = Ik hou van je
Indonesisch = Saya cinta padamu
Internetsprache, Herz-Emoticon = <3
Italienisch = Ti amo
Irisch = Tá grá agam ort
Isländisch = Eg elska thig
Japanisch = Kimi o ai shiteru
Javanesisch = Kulo tresno
Jugoslawisch = Ja te volim
Kanadisch-Französisch = Sh'teme
Klingonisch = bangwI' SoH
Korenaisch = Saranghae
Korsisch = Ti tengu cara
Kroatisch = Ja te volim
Kurdisch = Ez te hezdikhem
Latein = Te amo
Lettisch = Es tevi milu
Libanesisch = Bahibak
Litauisch = Tave myliu
Luxemburgisch = Ech hun dech gär
Madagassisch = mitia ianao aho
Mazedonisch = Te ljubam
Maltesisch = Jien inhobbok
Marokkanisch = Kanbhik
Niederländisch = Ik hou van je
Norwegisch = Jeg elsker deg
Persisch = Man tora dust daram
Polnisch = Kocham cie
Portugiesisch = Eu te amo
Quenya (Tolkien)= Tye-meláne
Romanisch = Eau at am
Rumänisch = Te ador
Russisch = Ya tyebya lyublyu
Sanskrit = Anurag
Serbisch = Ljubim te
Slowakisch = Lubim ta
Slowenisch = Ljubim te
Spanien = Te amo
Srilankan = Mama oyata arderyi
Swahili = Ninikupenda
Schwedisch = jag älskar dig
Schweizerdeutsch = I liäbä di
Syrisch = Bhebbek
Tagalog = Mahal kita
Tamilisch = Naan unnai kadalikiren
Thaitisch = Ua here au ia oe
Thai = Phom rak khun
Tschechisch = Miluji te
Tunesisch = Nhebek
Türkisch = Ben seni seviyorum
Ukrainisch = Ja tebe kokhaju
Ungarisch = Szeretlek
Urdu = Main tumse muhabbat karta hoon
Vietnamesisch = Anh yeû em
Wallisisch = Rwy'n dy garu di
Wienersich = I hob Di vui liab
Yoruba = Mo Feran e
Zulu = Mena tanda wena



Bitte geben Sie den Code ein
* Pflichtfelder
  • Pharmk860 (Sonntag, 11. November 2012 06:42)

    Hello! kdbgdge interesting kdbgdge site! I'm really like it! Very, very kdbgdge good!

  • Ein Spaziergänger (Samstag, 06. Oktober 2012 15:02)

    Wahnsinnig viel Text und dennoch bin ich immer noch nicht dahintergekommen was diese Seite bezwecken will oder was uns der Webautor damit sagen will außer das wir als Individuum wertvoll sind.
    Ok, ich hab nie Psychologie studiert, vielleicht komme ich deswegen nicht dahinter.

    Fazit: Nicht mein Ding, sorry.

  • Anni (Montag, 25. Juni 2012 09:23)

    Hallo Berndt, herzlichen Glückwunsch zu diesen tollen Seiten die sehr inspirierend sind!
    Herzliche Grüße
    Noch eine kleine Geschichte von mir, die ich vor kurzem gelesen hatte.
    Der 40 Euro Schein
    Ein wohlbekannter Sprecher startete sein Seminar, indem er einen Scheck
    von 40 EURO hoch hielt.
    In dem Raum saßen insgesamt 200 Leute. Er fragte: „Wer möchte diesen
    Scheck haben?“
    Alle Hände gingen hoch.
    Er sagte: „Ich werde diesen 40 EURO Scheck einem von Euch geben, aber
    zuerst lasst mich eins tun.“
    Er zerknitterte den Scheck. Dann fragte er: „Möchte ihn immer noch einer
    Die Hände waren immer noch alle oben.
    Also, erwiderte er: „Was ist wenn ich das tue?“
    Er warf ihn auf den Boden und rieb den Scheck mit seinen Schuhen am
    dreckigen Untergrund. Er hob ihn auf, den Scheck; er war zerknittert
    und völlig dreckig. „Nun, wer möchte ihn jetzt noch haben?“
    Es waren immer noch alle Arme in der Luft.
    Dann sagte er: „Liebe Freunde, wir haben soeben eine sehr wertvolle
    Lektion gelernt. Was auch immer mit dem Geld geschah, ihr wolltet es
    haben, weil es nie an seinem Wert verloren hat. Es war immer noch und
    stets 40 EURO wert. Es passiert oft in unserem Leben, dass wir
    zu Boden geworfen, zerknittert, und in den Dreck geschmissen werden.
    Das sind Tatsachen aus dem alltäglichen Leben.
    Dann fühlen wir uns, als ob wir wertlos wären. Aber egal was passiert
    ist oder was passieren wird, DU wirst niemals an Wert verlieren.
    Schmutzig oder sauber, zerknittert oder fein gebügelt, DU bist immer
    noch unbezahlbar für all jene, die dich über alles lieben. Der Wert
    unseres Lebens wird nicht durch das bewertet, was wir tun oder wen wir
    kennen, sondern dadurch WER DU BIST.
    Du bist was besonderes - vergiss das NIEMALS!
    Zähle deine Segen, nicht deine Probleme.
    Fürchte nie, etwas Neues zu versuchen.
    Und denk daran:
    Einfache Leute haben die Arche gebaut - Fachmänner die Titanic.

Wie hat Ihnen Ihr Besuch auf unseren Seiten gefallen? Welchen Impuls wollen Sie anderen Menschen mit auf den Weg geben? Ihr Kommentar braucht nicht wie ein geschliffener Edelstein zu sein ;-) Sagen Sie einfach ganz spontan, was Ihnen in den Sinn kommt. Es genügt, wenn Sie Ihren Vornamen verwenden.  Vielen Dank für all die Beiträge, die Sie mir schon per E-Mail gesendet haben. Ich hoffe, dass die Kommentar-Funktion den Gedankenaustausch noch zusätzlich erleichtert. Viel Freude beim Veröffentlichen Ihrer Ideen und beim Mitgestalten dieser Seite!



Herzlich willkommen im internationalen Hafen der Impulse! 



NEU >>

NEU >>

NEU >>

NEU >>


Video-Impressionen >>



(damals "Begegnungskreis Trier")




~~~TreffPunkte & TreffZeiten~~~


Newsletter kostenlos anfordern mit Kontaktformular


Besuche seit 05.06.2012         


**Tages-Besuchs-Rekord/A: 28.09. >> 244

**Tages-Besuchs-Rekord/B: 30.10. >> 430

**Tages-Besuchs-Rekord/C: 30.01. >> 588

**Tages-Besuchs-Rekord/D: 11.02. >> 2059

**Besuchs-Mittelwert 06-08/2012 >>  25.9

**Besuchs-Mittelwert 09/2012  >> 105.6

**Besuchs-Mittelwert 10/2012  >> 144.2

**Besuchs-Mittelwert 11/2012  >> 247.3

**Besuchs-Mittelwert 12/2012  >> 277

**Besuchs-Mittelwert 01/2013  >> 280

**Besuchs-Mittelwert 02-03/2013  >> 493

**Seitenaufrufe bis 17.04, 00:00 >> 207301


NEUE ZauberOrtsMarke von Julia

NEUE BegegnungsOrtsMarke von tinchen



Webcam Positano / Amalfiküste / Italien
Webcam Ozeanographisches Institut Split / Dalmatien / Kroatien
Webcams Nizza / Côte d'Azur / Südfrankreich
Webcams Marseille / Südfrankreich
*** Wie gefällt Ihnen diese Homepage auf einer Skala von 0 (schlecht) bis 100 (super)? Über Anregungen und Verbesserungsvorschläge freue ich mich. *** Hier können Sie auch den kostenlosen Newsletter anfordern. ***
Bitte geben Sie den Code ein

Hinweis: Felder, die mit * bezeichnet sind, sind Pflichtfelder.


auch erreichbar via



Deutschlandbund (

Europassage (

Weltzoom (

Wertemarke (

Studibund Deutschland (

Alumnibund Deutschland (

UniversitätsClub Deutschland / UniversityClub Germany / unicl (www.universtitä , ,

unisextant (

ErstiClub Deutschland (

youniveau (

younisono (

eurekapool (

UniClubTrier (


Der OzeanClub ist weiterhin auch über diese Adressen erreichbar.


Wir bekennen uns zur Gleichberechtigung von Mann & Frau und distanzieren uns dementsprechend von Standesdünkel, Burschenschafts-Stumpfsinn und allen ewiggestrigen Institutionen (natürlich in der Hoffnung, dass der Wind der Reformen auch die stursten Betonköpfe erfasst ;-). Wir engagieren uns dafür, die Hegemonie der Geschlechtsrollen, Nationalismen und trennenden Weltanschauungen durch die Macht des Geistes und der Verbundenheit abzulösen. Fortschrittlich denkende und handelnde Menschen sind in unseren Reihen herzlich willkommen und werden unsere ganze Unterstützung erfahren.


LuxInvictus SolAeterna !


powered by global thinkers & artists


 von griechisch Ὠκεανός („Ozean“), der die Erde umfließende Weltstrom

Ozean steht auch sinnbildlich für Weite, Aufbruch und all das, was uns Menschen auf diesem Planeten miteinander verbindet, als Kontrastprogramm zu engstirniger Rechthaberei, Egoismus, zerstörerischem Profitstreben, Herrschaft über Menschen, Materialismus und Intoleranz. Somit will der OzeanClub Deutschland seinen Beitrag zu einer gesunden und freudvollen Zukunft in unserer wunderbaren Welt leisten, über alle Grenzen von Nationalität, Hautfarbe, Konfession und Ideologie hinweg. Er sieht sich in Verwandtschaft mit anderen internationalen Communities, die sich dem Ziel widmen, eine zukunftsfähige Weltgemeinschaft sowie einen nachhaltigen Lebensstil zu fördern. Im Rahmen von Ausbildung und Studium, in Unternehmen und Institutionen bringen wir in den unterschiedlichsten Fachbereichen unsere Ideen ein im Interesse eines werteorientierten, menschlichen und zukunftsfähigen Miteinanders. Wir finden Befriedigung darin, schon heute an der Gesellschaft von morgen zu arbeiten. Anstatt zu warten, dass "die da oben" etwas ändern, packen wir es selbst an. Gemeinsamer Nenner der Mitglieder des OzeanClubs ist ihre Begeisterung für die Schönheit des Planeten und die Faszination des Lebens, das Bewusstsein unserer gemeinsamen Verantwortung und Mitgestaltungskraft sowie die Freude an Begegnung, Feiern, Kontakt mit der Natur und anderen Kulturen, Reisen und inspirierendem Gedankenaustausch. Auf dieser Basis sind schon viele Freundschaften, Partnerschaften und berufliche Kooperationen entstanden. Die Regionalgruppen kommunizieren über diese Homepage, den E-Mail-Verteiler und mit Hilfe der sozialen Netzwerke. Gründungsort der Initiative ist Trier/Moselland.




JETZT auch noch einfacher zu erreichen via


Assoziiert (Auswahl) ... teilweise eine VorBilderGalerie

We thank you for your contributions!

>> Prof. Dr. Carl Sagan

>> Roberto Benigni

>> Thomas D

>> Thom Yorke (Radiohead)

>> Herbert Grönemeyer

>> Bill Hicks

>> Charles Eisenstein

>> Professor Dr. Peter Bieri

>> Dr. Manfred Lütz

>> Dr. Dieter Broers

>> Duran Duran

>> Peter Gabriel

>> Peter Russell

>> Eddie Vedder

>> Beautiful Chorus

>> François Lelord

>> Campino / Die Toten Hosen

>> Gregg Braden

>> Fiva MC

>> Beirut

>> Cio d'Or

>> VJ Heiligenblut

>> Vasco Rossi

>> Tim Bendzko

>> Jovanotti

>> Bethany Hamilton & Alana Blanchard

>> Eckhart Tolle

>> Lykke Li

>> Marteria, Yasha & Miss Platnum 

>> Jim Carrey

>> Silbermond

>> XAVAS / Xavier Naidoo

>> Seeed

>> Peter Fox

>> Deichkind

>> Valdi Sabev

>> Woody Allen

>> Tom Tykwer


>> The HUMAN Project/USA

>> Alle OzeanClub Mitglieder bei Xing

>> Alle OzeanClub Mitglieder bei Linkedin

>> Ausgewählte Google+-Gruppen

>> Ausgewählte Facebook-Gruppen

>> RSA (Royal Society for the encouragement of Arts, Manufactures and Commerce)/UK

>> Occupy Wallstreet Movement

>> Aktion Deutschland Hilft

>> Greenpeace

>> Slow Food Deutschland

>> Slow Travel

>> CouchSurfing

>> Forum Anders Reisen

>> Verkehrsclub Deutschland

>> Verträglich Reisen

>> Deutsche Bahn

>> Dr. Tigges Studienreisen

>> nachhaltiger reisen

>> SKR StudienKontaktReisen

>> Phoenix Reisen

>> RivaReisen

>> HurtigRuten

>> TUI Cruises

>> tripadvisor

>> Google Earth

>> Denkwerk Zukunft - Stiftung kulturelle Erneuerung

>> Kulturraum Trier e.V.

>> Story of Stuff

>> Utopia

>> Konsumpf - Forum für kreative Konsumkritik

>> Hohe Luft - Philosophie-Magazin für alle, die Lust am Denken haben

>> Psychologie Heute

>> Unicum

>> Audimax


>> StepStone

>> experteer

>> Placement24

>> Contact & Cooperation

>> Human Resources Manager

>> Institut für Werteorientierte Unternehmensführung

>> Lexikon der Nachhaltigkeit

>> sustainable Unternehmensberatung

>> SustainAbility

>> sustainability-congress

>> Deutscher Nachhaltigkeits-Preis

>> Fürstenberg-Institut

>> EthikBank

>> UmweltBank

>> GLS Bank

>> fritz-kola

>> hessnatur

>> trigema

>> Fairtrade Deutschland

>> Transparency International Deutschland

>> Deutsches Netzwerk Wirtschafts-Ethik

>> Bundesverband Ethik

>> Studienstiftung des Deutschen Volkes

>> Deutscher Akademischer Austauschdienst

>> SOKRATES / ERASMUS - Programm

>> Exzellenzinitiative

>> Die Zeit

>> Die Zeit Campus

>> Die Zeit Wissen

>> UniSpiegel

>> Deutschlandfunk

>> SWR2

>> Arte

>> attac Deutschland

>> Du-Bist-Deutschland

>> Deutschland Land der Ideen

>> Existenzgründerforum des BMWi

>> Bundesministerium für Bildung und Forschung

>> Bundesministerium für Umwelt, Naturschutz und Reaktorsicherheit

>> Bundesministerium für Unterricht, Kunst und Kultur

>> Kulturportal Deutschland

>> LobbyControl

>> Oxford University Cortex Club


>> Max-Planck-Gesellschaft

>> Universitätsclub Bonn

>> KölnAlumni

>> Internationaler Universitätsclub München

>> Universitäts.Club Klagenfurt

>> Universitäts-Club Innsbruck

>> The University Women's Club London

>> City University Club London

>> University of St Andrews Alumni Club London

>> Columbia University Club of London

>> University of London Boat Club

>> Durham University Cycling Club

>> Oxford University Club

>> Oxford and Cambridge Club

>> The Royal Northern & University Club Aberdeen

>> Georgetown Alumni Club of United Kingdom

>> University Club of Chicago

>> University Club of Jacksonville

>> University Club of Milwaukee

>> University Club of New York

>> University Club of Pittsburgh

>> Todd J Sheridan: Birds Eye Videos

>> Charles Veitch & Danny Shine: Everything is OK & The Love


NEU in Kooperation mit spreadshirt >> Interaktive Kleidung im blickshirt shop


Ich freue mich sehr über den regen Zustrom. Hinter all diesen Zahlen stehen unverwechselbare Menschen. Bald werdet Ihr Gelegenheit bekommen, Euch kennenzulernen. Den größten Lohn für meine Arbeit könnt Ihr mir durch eine kleine Rückmeldung zukommen lassen. Am schönsten wäre es, wenn Ihr sie im "Fliblibuch" veröffentlicht, zum Beispiel durch eine Info über einen Eurer Lieblingsorte, vielleicht in Verbindung mit einem persönlichen Gedanken oder einem Zitat ... so haben alle was davon. Danke im voraus!

Beste Grüße, Berndt Ebler

;-) ... eine wunderbare Geschichte

Empfehlen Sie diese Seite auf:


Jovanotti: "Baciami Ancora"

Pearl Jam: "Oceans" (Unplugged)

Silbermond: "Krieger des Lichts"

Cio D'Or: "Origami Radiomix OceanClub 2007/VJ Heiligenblut"

Ich & Ich: "Vom selben Stern"

Lykke Li: "I Follow Rivers"

Valdi Sabev: "We Are Free"

Eddie Vedder: "Society"

John Butler Trio: "Ocean"

Eastern Sun: "Beautiful Being"

Die Fantastischen Vier: "Tag am Meer"

"Fractal Universe - We Are All Connected"

CRO: "Du"

Peter Gabriel: "The Book of Love"

Valdi Sabev: "Deep Blue Ocean"

Contact Intro

Contact Trailer

"Breath of Love" (Der Atem der Liebe)

Thom Yorke: "Harrowdown Hill"

Dire Straits: "Brothers in Arms"

Pray: "Lichtregen"

Fiva MC: "Dein Lächeln verdreht Köpfe"

Vasco Rossi: "Va Bene Cosi"

Fiva MC ft. Aphroe: "Magie"

Fiva MC: "Klarsicht"

"So Much Beauty In The World"

Leonard Cohen: "Poen"

Leonard Cohen: "Angels"

Jim Morrison: "An American Prayer"

Fiva MC: "Hallo"

Fiva MC: "Süd sehen"

Silbermond: "Ja" (Klavierversion)

Samuel Barber: "Adagio for Strings"

"Captain Future" Soundtrack

"The Ocean" Chillout Music



Hier kannst Du kostenlos die Aufnahme in den E-Mail-Verteiler anfordern, um Veranstaltungsinfos zu erhalten. Im Feld "Name" genügt Dein Vorname.

Je nach Anfrage-Aufkommen kann es einige Tage dauern, bis der erste Newsletter über gemeinsame Aktivitäten bei Dir eintrifft. Ich bitte um Verständnis.

Die Mitgliedschaft im OzeanClub E-Mail-Verteiler ist kostenlos.

Außer Vorname und E-Mail-Adresse sind keine persönlichen Angaben erforderlich. Es wird kein Profil erstellt. Ich gebe mein Ehrenwort, dass die E-Mail-Adressen nicht an Dritte weitergeleitet werden.

Des weiteren kann ich versichern, dass es zu keiner Analyse von Nutzungsverhalten und Verwendung solcher Erkenntnisse für Marketing-Zwecke kommt (leider Unsitte bei manchen Anbietern).

Der OzeanClub bleibt im Gegensatz zu zahlreichen anderen Angeboten ein Ort frei von eingeblendeten Werbebannern.

Der Newsletter (und damit auch die Mitgliedschaft) kann jederzeit ohne Angabe eines Grundes formlos via Kontaktformular gekündigt werden. Es erfolgt keine Datenspeicherung.


Hinweis: Felder, die mit * bezeichnet sind, sind Pflichtfelder.

OzeanClub Deutschland &



Forum für Positive Psychologie,

Freiheit, Selbstmanagement,

Engagement, Reisepsychologie und Gesundheitsförderung


proudly participating in the World Consciousness Movement


member of associated LatentNetworkConceptArtists


in Community with Global UniversityClubs


>> Leitung: Berndt Ebler

Diplom-Psychologe, Psychotherapeut, WebAutor, Fotograf, Reiseleiter, Hobbydesigner und vor allem Mensch ;-)


>> zusätzlich im Team: Diplom-Psychologinnen und Diplom-Psychologen für online-Coaching, 1 Wirtschaftspsychologin (Schwerpunkt Recruiting und Personalentwicklung), 1 Philosoph, 1 Oberstudienrat a.D., 1 Verkehrsflugzeugführer (Germanwings) & 1 freischaffende Künstlerin in beratender Funktion


Verbindlichsten Dank an meine Eltern und indirekt auch den deutschen Staat für die Anschubfinanzierung! Nach und nach wird der Club es schaffen, auf eigenen Beinen zu stehen und zu gehen. Wir werden unsere Energie dafür einsetzen, unsere Gesellschaft, Europa und die Welt auch in Eurem Sinne und in Übereinstimmung mit dem Wesensgehalt der deutschen Verfassung (unabhängig von aktueller politischer Führung) zu gestalten und dafür qualifizierte, motivierte MitstreiterInnen zu gewinnen.


>> Universität Trier

Wissenschaftspark auf dem Petrisberg / NoSiliconHill


E-Mail: (berndt mit "dt")




It's not about numbers on papers and people.

It's not about obedience or being "useful".

It's all about being yourself and being together.

It's all about feelings, values and community.

It's about Life.



Per E-Mail können Sie mit mir auch ein kostenloses telefonisches Informationsgespräch vereinbaren. Da ich vielen Menschen diese Möglichkeit bieten möchte, bitte ich um Verständnis, dass die Dauer dieses Gespräches maximal 10 Minuten betragen kann.


Sie wollen in den Newsletter-Verteiler aufgenommen werden? Nichts leichter als das ... eine textfreie E-Mail mit dem Stichwort "Verteiler" in der Betreffzeile genügt.


Diese kleine Erlebnis- und Bildungswelt, die auch eine Hymne an die Wunder unseres Planeten ist, entwickelt sich ständig weiter. Kommen Sie mit auf die Reise und seien Sie gerne immer wieder mal Gast! Ich würde mich freuen, wenn es für Sie zu einer Schatzsuche wird, in deren Verlauf Sie immer besser für sich herausfinden, wer Sie wirklich sind, was in Ihnen steckt und wie Sie diese Begabungen und Träume umsetzen können.


Irgendwann ist es für mich in meiner Eigenschaft als Psychologe naheliegend geworden, nicht nur auf die Symptome, Wertvorstellungen, Kraftquellen und Veränderungsmöglichkeiten meiner Patientinnen und Patienten zu schauen, sondern auch auf die Lebensbedingungen in unserer Gesellschaft. Diese bieten uns zwar viel Komfort und glänzende Fassaden, bilden aber gleichzeitig auch den Nährboden für Mangelzustände und Überforderungen der Seele. Psychotherapeut in einem umfassenderen Sinne zu sein bedeutet für mich also auch, meinen kleinen Beitrag dazu zu leisten, unsere Gesellschaft lebenswerter zu machen. Seien Sie mit von der Partie ... zusammen verändern wir das soziale Klima von unten nach oben!


Musik, Fotos und Videofilme wurden bewusst so ausgewählt, dass mit ihrer Hilfe Entspannung gefördert sowie Phantasie und Kreativität angeregt wird. Durch den Schatz an positiven Impressionen kann der Übergang zwischen Arbeit, Feierabend und Nachtruhe erleichtert werden. Auf sanfte Art und Weise verbessert sich so die Grundstimmung , wird Ausgeglichenheit gefestigt.


Einige Beiträge sollen das eigenständige Denken hinsichtlich gesellschaftlicher Zusammenhänge begünstigen. Sie sind an entsprechenden Stichwörtern zu erkennen, die ihnen zugeordnet sind. Hierbei handelt es sich naturgemäß um weniger leichte Kost. Diese sollten besser nicht direkt vor dem Schlafengehen betrachtet werden.


Achtung! Es ist ein fließender Übergang zwischen Fakten, Spekulation, beschwichtigender Verharmlosung und Verschwörungstheorien. So sehr Gedankengebäude auch in sich stimmig wirken mögen, so überzeugend Rhetorik von allen Seiten auch daherkommt ... bilden Sie sich ihre eigene Meinung! Es ist mir bewusst, dass es teilweise schwer sein kann, die "Tatsachen" zu überprüfen. Wir sind alle darauf angewiesen, Vertrauensvorschuss zu geben. Zu bedenken ist meines Erachtens noch, dass nicht alles, was unglaublich oder erschreckend klingt, von vornherein ein Produkt der Phantasie sein muss. Es gibt auf unserem Planeten nun mal Zusammenhänge und Zustände, die uns in Versuchung bringen, Augen und Ohren zu schließen und weiter an die "heile Welt" zu glauben und daran, dass "die da oben" es schon richten werden. Verstehen kann weh tun, es bietet allerdings auch die Chance zum Erwachsenwerden.


Ich empfehle Ihnen, sich ein Limit zu setzen für die Zeit, die Sie im Internet verbringen, so faszinierend die Eindrücke auch sein mögen! Wie sagt man so schön: Die Dosis macht den Unterschied zwischen Gift und Heilmittel.


Ihre Meinung interessiert uns. Deswegen würden wir uns freuen, wenn Sie in unserem Gästebuch am Fuße der Startseite einen Kommentar veröffentlichen.


Sie möchten diese Entdeckung weiterempfehlen? Die entsprechende Funktion für persönliche Mitteilungen finden Sie im farblich unterlegten Feld am Fuße der Seite. Wenn Sie möchten, können Sie natürlich auch auf den Dienst "Facebook" zurückgreifen. Wenn Sie sich selbst dort registrieren lassen wollen, empfehle ich Ihnen, vorsichtig mit Ihren persönlichen Daten umzugehen. So gut die Basisidee dieses Netzwerkes auch sein mag ... Datenmissbrauch im Interesse der Profitmaximierung kann leider nie ganz ausgeschlossen werden. Durch die Verbreitung von Ideen der Aufklärung und die Förderung guter zwischenmenschlicher Beziehungen hingegen kann die intelligente Erfindung "Facebook" durchaus einen höheren, zukunftsweisenden Wert für diesen Planeten entfalten. Vielleicht war das ja ursprünglich mal der Traum des Gründers ;-)


We face the facts and the beauty of life. We change the booking for a better trip. Tick Tack, Click Clack, the sound of a peaceful revolution. Be part of the music!



Ready for the Mystery? Let the flight begin! Check in & Take off ...

Empfehlen Sie diese Seite auf:

Timeless Captain Future ;-)

Billions of Hearts

One World of Nature

One Dream of Love

Change Can Happen

We Decide

It's a Chain Reaction of Freedom

It's Up to You

B.E., 19.07.2012


Studierst Du an einer Universität oder Fachhochschule? Wenn ja, kannst Du mir eine textfreie E-Mail mit dem Stichtwort "Campus-Newsletter" schicken. Dann erfährst Du von der nächsten CampusDreamTeams - Veranstaltung in Deiner Nähe. Im Rahmen dieser kostenfreien Treffen (keine Mitgliedschaft, keine Beiträge), die wir unabhängig von Sponsoren-Interessen verwirklichen, bekommst Du Gelegenheit, anderen Mitstudierenden zu begegnen, die Lust auf inspirierende, lebendige Kontakte von Angesicht zu Angesicht haben.


Hier findest Du aufgeschlossene Leute, die wie Du das Bedürfnis verspüren, mehr Tiefe, Gemeinschaft und Leichtigkeit in ihr Leben zu bringen sowie auf privater und gesellschaftlicher Ebene einen Beitrag zu einer besseren Zukunft zu leisten, die es spannend finden, Teil einer Veränderungskraft zu werden, die frei ist von Parteien und Institutionen, deren gemeinsamer Nenner die Liebe zum Leben und das Verantwortungsbewusstsein gegenüber unserem wunderbaren Planeten ist.


Nach und nach können wir die Hochschulen miteinander vernetzen. Ihr werdet in den nächsten Jahren und Jahrzehnten die Schlüsselpositionen unserer Gesellschaft einnehmen. Durch Eure Bildung könnte Ihr Zusammenhänge besser erkennen. Ihr habt die Chance, in jeder Hinsicht einem positiven Klimawandel Auftrieb zu geben.


Die gemeinsame Vision wird zum Boden für intensive, werteorientierte Freundschaften und wenn wir zu Tausenden entscheiden (the sky is the limit ;-) , wenn wir uns dafür entscheiden, wegweisend zu handeln, werden wir voller Begeisterung spüren, wie viel Einfluss wir haben. Ich freue mich schon jetzt auf unser erstes Deutschlandtreffen. Das wird eine Party! ... mit Niveau.


Wenn wir uns alle zusammentun, erschaffen wir die erste "Lobby" zum Wohle der Weltgesellschaft. So werden wir erfahren, wie gut sich Leben anfühlen kann. Mobilisiere das Freundschaftsnetzwerk, das Du Dir durch Dein Engagement aufgebaut hast und wir werden gemeinsam etwas erleben, das noch viel mehr Spaß macht als "Flashmobs" und das, vor allem, viel mehr bewegen wird, in uns, in unserem Club der Gesellschaftsgestaltung sowie in der Welt, die uns umgibt.


Wir freuen uns auf Dich und Deine Ideen und wünschen uns, dass Du mit uns einige der besten Stunden Deiner Studienzeit genießen kannst, in einem neuen Wachstums- und Erlebnisraum, auf der Spielwiese des wachen Bewusstseins.


Sie können Sich momentan nur wenig Zeit nehmen? >> Meine Empfehlung für die Stärkung zwischendurch

***"Julia's Dream"


Zeitbedarf: Die Ewigkeit



***Contact Intro (Hommage an Carl Sagan)


Zeitbedarf: Lichtjahre





Zeitbedarf: Ein Augenblick





Zeitbedarf: 21 Sekunden



***Fractal Universe - We Are All Connected


Zeitbedarf: 5 Minuten und 48 Sekunden



***Eine Hymne an unseren Planeten


Zeitbedarf: 3 Minuten und 2 Sekunden



***Tim Bendzko: "Sag einfach Ja"


Zeitbedarf: segelt schon durch eine andere Dimension



***Vasco Rossi: "Brava Giulia" (brava = scharfsinnig / erfinderisch)


Zeitbedarf: 5 Minuten und 19 Sekunden



***Mark Knopfler: "Romeo and Juliet"


Zeitbedarf: 7 Minuten und 49 Sekunden



***Van Morrison: "Brown Eyed Girl"


Zeitbedarf: 3 Minuten und 4 Sekunden



***Boney M.: "Sunny"


Zeitbedarf: 4 Minuten und 24 Sekunden



***Johnny Nash: "I can see clearly now"


Zeitbedarf: 2 Minuten und 57 Sekunden



***Eine Szene aus dem Film "Sie leben"von John Carpenter


Zeitbedarf: 4 Minuten und 20 Sekunden



***"Fireflower" (von Pierre Michel, Paris)


Zeitbedarf: 45 Sekunden



***NEW YORK VOICES: "On a Clear Day"  at Java Jazz Festival


Zeitbedarf: 5 Minuten und 42 Sekunden



***Particle Effects


Zeitbedarf: 1 Minute und 16 Sekunden



***Peter Gabriel & Kate Bush: Don't Give Up"


Zeitbedarf: 6 Minuten und 12 Sekunden





Zeitbedarf: 2 Minuten und 2 Sekunden



***Lorenz Strange Attractor Evolution


Zeitbedarf: 4 Minuten und 39 Sekunden



***Led Zeppelin: "Stairway to Heaven"


Zeitbedarf: 10 Minuten und 52 Sekunden



***"The Swift Uplifting Rush of Quiet Birds in Circling Flight"


Zeitbedarf: 1 Minute und 57 Sekunden



***Zündende Ideen (von Pierre Michel, Paris)


Zeitbedarf: 1 Minute und 19 Sekunden



***Frida Gold: "Nackt vor Deiner Tür"


Zeitbedarf: 4 Minuten und 20 Sekunden



***Helge Schneider: "Philosophie"


Zeitbedarf: 7 Minuten und 5 Sekunden



***Toroidal Vortices


Zeitbedarf: 4 Minuten und 2 Sekunden



***Nena: "Liebe Ist"


Zeitbedarf: 4 Minuten und 56 Sekunden



***Fractal Zoom Mandelbrot Corner


Zeitbedarf: 1 Minute und 40 Sekunden



***"An Ordinary Day" (Kurzfilm)


Zeitbedarf: 3 Minuten und 30 Sekunden



***Peter Gabriel: "The Power of the Heart"


Zeitbedarf: 5 Minuten und 55 Sekunden



***"Particle Orchestra - Trapcode Form"


Zeitbedarf: 1 Minute und 52 Sekunden



***David Bowie: "Heroes"


Zeitbedarf: 3 Minuten und 28 Sekunden





Zeitbedarf: 1 Minute und 32 Sekunden



***Von Banken und Streubomben - Abstimmen mit den Füßen durch Bankwechsel


Zeitbedarf: 5 Minuten und 30 Sekunden



***Die Kraft der Veränderung (von Pierre Michel, Paris)


Zeitbedarf: 1 Klick und 33 Sekunden



***Banken für eine bessere Zukunft.1: Die GLS Bank


Zeitbedarf: 3 Minuten und 4 Sekunden



***Banken für eine bessere Zukunft.2: Die EthikBank


Zeitbedarf: 3 Minuten und 9 Sekunden



***Banken für eine bessere Zukunft.3: Die Umweltbank


Zeitbedarf: 4 Minuten und 23 Sekunden



***Modified Lorenz Attractor


Zeitbedarf: 1 Minute und 13 Sekunden



***Intro Matrix Reloaded


Zeitbedarf: 1 Minuten und 27 Sekunden



***10 Methoden der Manipulation


Zeitbedarf: 4 Minuten und 46 Sekunden



***Helge Schneider: "Erziehung"


Zeitbedarf: 2 Minuten und 3 Sekunden



***David Bowie: "We Prick You"


Zeitbedarf: 4 Minuten und 21 Sekunden



***Helge Schneider: "Es gibt Reis"


Zeitbedarf: 4 Minuten und 1 Sekunde



***Günter Wallraff zu Sarrazin


Zeitbedarf: 4 Minuten und 11 Sekunden



***"Lobbyismus für Dummies"


Zeitbedarf: 3 Minuten und 18 Sekunden



***Vasco Rossi: "Eh Già"


Zeitbedarf: 3 Minuten und 45 Sekunden



***Sinnlos im Weltraum.1


Zeitbedarf: 8 Minuten und 13 Sekunden



***Rapucation: "Guten Appetit"


Zeitbedarf: 3 Minuten und 51 Sekunden



***Manipulation der Massenmedien


Zeitbedarf: 10 Minuten und 3 Sekunden



***Trailer zum Film "Free Rainer"


Zeitbedarf: 2 Minuten und 6 Sekunden



***Der Film "Free Rainer"


Zeitbedarf: 1 Stunde, 1 Minute und 25 Sekunden + 45 Minuten und 28 Sekunden



***David Bowie: "Underground"


Zeitbedarf: 4 Minuten und 53 Sekunden





Zeitbedarf: 1 Minute und 37 Sekunden



***"Ein Münchner im Himmel"


Zeitbedarf: 10 Minuten und 26 Sekunden



***Klima retten und Umsatz machen - Konzerne spielen sich als Umweltretter auf


Zeitbedarf: 6 Minuten und 1 Sekunde





Zeitbedarf: 7 Minuten und 31 Sekunden



***Auf der Schnellstraße in die Dunkelheit?


Zeitbedarf: 1 Minute und 16 Sekunden



***AVP (von Pierre Michel, Paris)


Zeitbedarf: 37 Sekunden



***Das Mentale Gefängnis und die Chance zur Freiheit


Zeitbedarf: 6 Minuten und 45 Sekunden



***Sensitivity to Initial Conditions (Butterfly Effect) Demonstrated on a Lorenz Attractor


Zeitbedarf: 2 Minuten und 50 Sekunden



***Led Zeppelin: "No Quarter"


Zeitbedarf: 10 Minuten und 7 Sekunden



***Manipulation im Alltag


Zeitbedarf: 14 Minuten und 36 Sekunden



***"Mystery Man" (Szene aus dem Film "Lost Highway")


Zeitbedarf: 3 Minuten und 10 Sekunden



***Frida Gold: "Waffen und Pferde"


Zeitbedarf: 3 Minuten und 4 Sekunden



***Crazy Chain Reaction Domino Thing


Zeitbedarf: 2 Minuten und 30 Sekunden



***Roni Size: "New Forms"


Zeitbedarf: 7 Minuten und 44 Sekunden



***Platon: "Das Höhlengleichnis" ,


Zeitbedarf: 7 Minuten und 25 Sekunden + 5 Minuten und 32 Sekunden



***Eine Parodie auf das Rettersyndrom und Heilsversprechen: "Get on Board" (Thomas D.)


Zeitbedarf: 3 Minuten und 44 Sekunden



***Lou Reed: "Walk on the Wild Side" ,


Zeitbedarf: 5 Minuten und 55 Sekunden + 1 Minute und 22 Sekunden



***"Signs" - A Romantic Film


Zeitbedarf: 12 Minuten und 12 Sekunden



***Ich & Ich: "Stark"


Zeitbedarf: 5 Minuten und 9 Sekunden



***Dead Kennedys vs Gill Scott Heron: "The Revolution will not be televised"


Zeitbedarf: 2 Minuten und 36 Sekunden





Zeitbedarf: 2 Minuten und 24 Sekunden



***Frida Gold: "Aufgewacht"


Zeitbedarf: 4 Minuten



***Strange Attractor on CRO


Zeitbedarf: 4 Minuten und 3 Sekunden



***Auslaufmodell Konsumgesellschaft


Zeitbedarf: 4 Minuten und 39 Sekunden



***Helge Schneider: "Der viereckige Hai"


Zeitbedarf: 1 Minute und 36 Sekunden



***Wegwerfgesellschaft durch Mindeshaltbarkeitsdatum


Zeitbedarf: 3 Minuten und 15 Sekunden



***Die Ärzte: "Lasse redn"


Zeitbedarf: 2 Minuten und 49 Sekunden



***Prodigy: "No Good"


Zeitbedarf: 6 Minuten und 17 Sekunden



***"Der kaputte Fernseher" (Loriot)


Zeitbedarf: 2 Minuten und 39 Sekunden



***Staatsverschuldung einfach erklärt


Zeitbedarf: 4 Minuten und 57 Sekunden



***Helge Schneider: "Im Tabakladen"


Zeitbedarf: 4 Minuten und 50 Sekunden



***Volker Pispers: "Ablenkung"


Zeitbedarf: 2 Minuten und 30 Sekunden



***Nena: "99 Luftballons"


Zeitbedarf: 3 Minuten und 50 Sekunden



***Pixies: "Where Is My Mind?"


Zeitbedarf: 3 Minuten und 55 Sekunden



***David Bowie: "I'm Deranged" & "Joe the Lion"


Zeitbedarf: 9 Minuten und 42 Sekunden



***Im Rausch der Schnelligkeit


Zeitbedarf: 2 Minuten und 2 Sekunden



***Helge Schneider: "Praxis Dr. Hasenbein" / Peterchen will nicht zu Bett gehen


Zeitbedarf: 1 Minute und 33 Sekunden



***Clint Mansell: "Pi r^2"


Zeitbedarf: 2 Minuten und 48 Sekunden



***WeGreen - eine Partei oder ein Golfplatz oder ...?


Zeitbedarf: 1 Minute und 36 Sekunden



***Vasco Rossi: "Il Mondo Che Vorrei"


Zeitbedarf: 6 Minuten und 51 Sekunden



***Sinnlos im Weltraum.2


Zeitbedarf: 9 Minuten und 11 Sekunden



***Pharma-Lobbyist sagt versehentlich die Wahrheit


Zeitbedarf: 3 Minuten und 42 Sekunden



***Creed: "Bullets"


Zeitbedarf: 3 Minuten und 40 Sekunden



***"Döschen auf, Pille rein" (Georg Schramm)


Zeitbedarf: 4 Minuten und 55 Sekunden



***Trailer zum Film "Equilibrium - Killer of Emotions"


Zeitbedarf: 2 Minuten und 13 Sekunden



***Tribute to Pi and Darren Aronofsky


Zeitbedarf: 7 Minuten und 20 Sekunden



***"Auf der Rennbahn" (Loriot)


Zeitbedarf: 3 Minuten und 44 Sekunden



***Hommage an Bill Hicks anlässlich seines viel zu frühen Todes


Zeitbedarf: 5 Minuten und 11 Sekunden



***Frida Gold: "Morgen"


Zeitbedarf: 3 Minuten und 33 Sekunden



***Lou Reed: "This Magic Moment"


Zeitbedarf: 3 Minuten und 55 Sekunden



***Clint Mansell: "Stay with Me"


Zeitbedarf: 3 Minuten und 36 Sekunden



***Sinnlos im Weltraum.3


Zeitbedarf: 3 Minute und 38 Sekunden



***Die Kosten des Billigen und der Gier am Beispiel kik ,


Zeitbedarf: 14 Minuten und 40 Sekunden + 14 Minuten und  3 Sekunden



***Hintergründe Zeitarbeit


Zeitbedarf: 6 Minuten und 5 Sekunden



***Frida Gold: "Unsere Liebe ist aus Gold"


Zeitbedarf: 3 Minuten und 24 Sekunden



***Hedgefonds, Leerverkäufe und feindliche Übernahmen (Wirtschaftskrieg) einfach erklärt


Zeitbedarf: 6 Minuten und 19 Sekunden



***Gill Scott Heron & Brian Jackson: "It's Your World"


Zeitbedarf: 4 Minuten



***Ist der Kapitalismus wirklich ein Segen für die Menschheit? (Volker Pispers)


Zeitbedarf: 4 Minuten



***Goldfrapp: "Melancholy Sky"


Zeitbedarf: 3 Minuten und 17 Sekunden



***Rage Against the Machine: "Freedom"


Zeitbedarf: 6 Minuten



***"Die Volksdroge" (Loriot)


Zeitbedarf: 3 Minute und 36 Sekunden



***Ziviler Luftverkehr rund um die Welt (Simulation über 24 Stunden) ... wie soll das weitergehen?


Zeitbedarf: 1 Minute und 12 Sekunden



***Helge Schneider: "Auf den Spuren des Kara Ben Nemsi"


Zeitbedarf: 6 Minuten und 4 Sekunden



***"Eine unbequeme Wahrheit" (Ausschnitt aus dem Film von Al Gore)


Zeitbedarf: 2 Minuten und 10 Sekunden



***Helge Schneider: "Praxis Dr. Hasenbein" / Die Kochsendung


Zeitbedarf: 4 Minuten und 57 Sekunden



***"Weil es halt so lecker ist ..." (Hagen Rether)


Zeitbedarf: 6 Minuten und 31 Sekunden



***Rage Against the Machine: "With a Fistfull of Steel"


Zeitbedarf: 5 Minuten und 26 Sekunden



***Sinnlos im Weltraum.4


Zeitbedarf: 4 Minuten und 38 Sekunden



***Trailer zum Film "Let's Make Money" von Erwin Wagenhofer


Zeitbedarf: 14 Minuten und 40 Sekunden + 14 Minuten und  3 Sekunden



***Zauber der Zeitlupe


Zeitbedarf: 2 Minuten und 2 Sekunden



***"Sollen Hunde fernsehen?" (Loriot)


Zeitbedarf: 2 Minuten und 44 Sekunden



***Billy Joel: "Just The Way You Are"


Zeitbedarf: 5 Minuten und 3 Sekunden



***"Bottle", ein Film von Kirsten Lepore (USA, 2011)


Zeitbedarf: 5 Minuten und 31 Sekunden



***Sinnlos im Weltraum.5


Zeitbedarf: 4 Minuten und 40 Sekunden



***Frida Gold: "Wovon sollen wir träumen"


Zeitbedarf: 3 Minuten und 40 Sekunden



"Wer kontrolliert das Spinnennetz?" (Thesen von David Icke)


Zeitbedarf: 7 Minuten und 26 Sekunden



***Dead Kennedys: "California über alles"


Zeitbedarf: 3 Minuten und 26 Sekunden



***Der Lottogewinner (von Loriot, gespielt von Heinz Meier)


Zeitbedarf: 3 Minuten und 22 Sekunden



***"V for Vendetta" (Trailer)


Zeitbedarf: 2 Minuten und 24 Sekunden



***"V for Vendetta" (die Ansprache)


Zeitbedarf: 3 Minuten und 2 Sekunden



***Sinnlos im Weltraum.6


Zeitbedarf: 6 Minuten und 38 Sekunden



***Rede von David Icke


Zeitbedarf: 9 Minuten und 29 Sekunden



***Glenn Medeiros: "Nothing's Gonna Change My Love For You"


Zeitbedarf: 3 Minuten und 48 Sekunden



***Nachhaltigkeit einfach erklärt


Zeitbedarf: 4 Minuten und 6 Sekunden



***Jimi Hendrix: "Hey Joe"


Zeitbedarf: 4 Minuten und 4 Sekunden



"Balance" - ein Film von Wolfgang und Christoph Lauenstein (Deutschland, 1989)


Zeitbedarf: 7 Minuten und 32 Sekunden



***"Sinnlos im Weltraum.7


Zeitbedarf: 7 Minuten und 29 Sekunden



***Jovanotti: "Tutto l'Amore che ho"


Zeitbedarf: 4 Minuten und 16 Sekunden



***"Peaceful Warrior" / Die Szene auf der Brücke


Zeitbedarf: 3 Minuten und 5 Sekunden



***Desillusionierung im Scheinparadies


Zeitbedarf: 9 Minuten und 21 Sekunden



***"Red Pill / Blue Pill - It's Your Choice" (Schlüsselszene aus "The Matrix")


Zeitbedarf: 4 Minuten und 59 Sekunden



***The Art of Corporate Mind Control (George Carlin)  WIRKLICH SEXY IST NUR DIE GEGENMACHT ;-)


Zeitbedarf: 4 Minuten und 59 Sekunden



***Greenwashing - The Media Show


Zeitbedarf: 3 Minuten und 3 Sekunden



***Sinnlos im Weltraum.8


Zeitbedarf: 6 Minuten und 21 Sekunden



***Duran Duran: "Wild Boys"


Zeitbedarf: 6 Minuten und 32 Sekunden



***Trentemoller: "Miss You"


Zeitbedarf: 4 Minuten und 3 Sekunden



***Leckeres Essen (auch bei näherer Betrachtung)


Zeitbedarf: 4 Minuten und 3 Sekunden



***A-ha: "Stay On These Roads"


Zeitbedarf: 4 Minuten und 45 Sekunden



***Sinnlos im Weltraum.9


Zeitbedarf: 7 Minuten und 52 Sekunden



***Im Orbit unseres wunderbaren Planeten


Zeitbedarf: 5 Minuten



***"Sacred Economics" (ein Film basierend auf dem Buch von Charles Eisenstein)


Zeitbedarf: 12 Minuten und 8 Sekunden



***"Turbokapitalismus" (Hagen Rether)


Zeitbedarf: 3 Minuten und 17 Sekunden



***Invention of Love", ein Film von Andrey Shushov (2010)


Zeitbedarf: 9 Minuten und 44 Sekunden



***Sinnlos im Weltraum.10


Zeitbedarf: 8 Minuten und 34 Sekunden



***Lionel Richie: "Stuck on You"


Zeitbedarf: 4 Minuten und 30 Sekunden



***Thom Yorke: "Harrowdown Hill"


Zeitbedarf: 4 Minuten und 57 Sekunden



***"Krötenwanderung jetzt!"


Zeitbedarf: 1 Minute und 19 Sekunden



***Helge Schneider: "Pariserzählungen"


Zeitbedarf: 14 Minuten und 59 Sekunden



***Eine Party der außergewöhnlichen Art ... da bewegt sich was!


Zeitbedarf: 23 Minuten und 46 Sekunden



***Sinnlos im Weltraum.11


Zeitbedarf: 7 Minuten und 45 Sekunden



***Vasco Rossi: "Va Bene, Va Bene Così"


Zeitbedarf: 3 Minuten und 54 Sekunden



***"Validation" - ein liebenswerter Film über den Zauber des von Herzen kommenden Lächelns (USA, 2007)


Zeitbedarf: 16 Minuten und 24 Sekunden



***A-ha: "Take on Me"


Zeitbedarf: 3 Minuten und 44 Sekunden



***Jovanotti: "La Notte dei Desideri"


Zeitbedarf: 3 Minuten und 30 Sekunden



***Original-Humor an Bord der Enterprise.1


Zeitbedarf: 4 Minuten und 35 Sekunden



***Tanz der Wassertropfen


Zeitbedarf: 1 Minute und 34 Sekunden



***Frida Gold: "Denn Liebe ist ..."


Zeitbedarf: 3 Minute und 44 Sekunden



***Trailer zum Film "Work Hard - Play Hard" (schöne neue Arbeitswelt?)


Zeitbedarf: 2 Minuten und 43 Sekunden



***Pink Floyd: "Another Brick in the Wall" (richtet sich nur gegen eine ganz spezielle Form von "Unterrichtung" in Kindheit, Jugend UND Erwachsenenalter und soll gleichzeitig erinnern an all die großartigen Lehrerinnen und Lehrer, die wir erleben durften)


Zeitbedarf: 5 Minuten und 59 Sekunden



***"Helden by HEIMAT" (Juliane Elting & Marcelo Pellegrini singen David Bowies Lied in deutscher Übersetzung)


Zeitbedarf: 8 Minuten und 39 Sekunden



***Domino-Effekt mit physikalischen und elektronischen Mitteln


Zeitbedarf: 4 Minuten und 4 Sekunden



***Autechre: "Clipper"


Zeitbedarf: 8 Minuten und 34 Sekunden



***Was in aller Welt ist "The Meatrix"???


Zeitbedarf: 9 Minuten und 36 Sekunden



***Original-Humor an Bord der Enterprise.2


Zeitbedarf: 6 Minuten und 2 Sekunden



 ***A-ha: "Hunting High and Low"


Zeitbedarf: 3 Minuten und 47 Sekunden



***3Sat-Reportage: "Wenn Arbeit krank macht"


Zeitbedarf: 5 Minuten und 15 Sekunden



***Helge Schneider: "Auf dem Arbeitsamt"


Zeitbedarf: 4 Minuten und 43 Sekunden



***"Feierabend" (Loriot)


Zeitbedarf: 3 Minuten und 29 Sekunden



***Mr. Mister: "Broken Wings"


Zeitbedarf: 6 Minuten und 38 Sekunden



***"The Message" (Vermutungen / Glaubensvorstellungen von Bill Hicks und David Icke)


Zeitbedarf: 5 Minuten und 5 Sekunden



***Szenen einer Ehe - Loriot vs Angie Feat. Westerwelle


Zeitbedarf: 2 Minuten und 18 Sekunden



***Apparat: "Komponent"


Zeitbedarf: 4 Minuten und 21 Sekunden



***"Drecksblatt beleidigt den Fisch, der darin eingewickelt ist" (Volker Pispers über die Massenmedien)


Zeitbedarf: 9 Minuten und 27 Sekunden



***"Das Frühstücksei" (Loriot)


Zeitbedarf: 2 Minuten und 20 Sekunden



***"Tolerantia", ein Film von Ivan Ramadan (Bosnien, 2008)


Zeitbedarf: 6 Minuten und 20 Sekunden



***Jimi Hendrix: "All Along the Watchtower"


Zeitbedarf: 4 Minuten und 3 Sekunden



***Richard Harvey: "Clarity"


Zeitbedarf: 2 Minuten und 22 Sekunden



***Nena: Remix von "Liebe Ist"


Zeitbedarf: 5 Minuten und 10 Sekunden



***Led Zeppelin: "Whole Lotta Love"


Zeitbedarf: 8 Minuten und 37 Sekunden



***Lorenz 84 Attractor


Zeitbedarf: 26 Sekunden



***Cat Stevens: "Father and Son"


Zeitbedarf: 7 Minuten und 44 Sekunden



***Yann Tiersen: "Father and Mother"


Zeitbedarf: 2 Minuten und 54 Sekunden



***"Do not stand at my grave and weep" (Gedicht von Mary Elizabeth Frye, mit Fotos von Melanie Myers)



***"The Promise"



***Jim Morrison: "An American Prayer"



***The Doors: "Riders on the Storm"



***The Alan Parsons Project: "Old and Wise"



***Silbermond: "Krieger des Lichts"



***Die Fantastischen Vier: "Tag am Meer"



***Bill Hicks: "It's Just a Ride"




~ Aka Huna Aloha ~


Ho'o ponopono

Lono Ku Kane Kanaloa Po Ao

Nānā i ke kumu



Damit die Zusammenarbeit mit unserem Team für Sie reibungslos verläuft, haben wir einige Tipps für Sie in der KlientInnen-Information



Ich werde mich bemühen, Ihre E-Mail-Anfragen schnellstmöglich zu bearbeiten. Durch den Informations-Verteiler erfahren Sie kostenlos von geplanten Veranstaltungen und Reisen.




Abîme de Bramabiau Abruzzen Abschied
abstrakt abstrakte Kunst Abstraktion

Abulafia Adria Adriatisches Meer Aegadian Islands Aeolian Islands Aeolus

Ägadische Inseln Ägäis Ägäische Inseln Ägypten Äolische Inseln Äolus Äther
ätherische Kraft Ätherleib Ätna ABC-Modell der Gefühle Abenteuer Abhängigkeit
Ablehnung Abneigung Abraham Joshua Heschel Absolventen Absolventinnen
Abwehrmechanismen Abwertung Achintya Bhedabheda Achtsamkeit Adresse Advaita-Vedanta
Ärger ärgerlich ärgern Ästhetik Äther Affekt Affektive Störungen Afrika
Afrikanisches Meer Agamas ahamkara Ahnengeist ainigma Aiolos Airstrip
Ajapa-Mantra Aka Aka-Chord Aka-Cord Akademie Akademiker Akademikerinnen
Aka-Faden Aka-Feld Aka-Flow Aka-Fluss Aka-Gedankenform Aka-Netz Aka-Schnur
Aka-String Aka-Telefon Aka-Vibration Aka-Welle Aktion aktiv Aktivismus
Aktivitäten akustisch Akzeptanz Akzeptanz- und Commitmenttherapie Al-Ghazali
Albert Einstein Alborán-Meer Algarve Alghero Alicudi Allah Alleinlebende Aloha
Alpen ἄλφαAlphabet
Alpha Centauri Alpha Wave Alternative Medien versus Mainstream alternativer
Lebensstil Alternativheilverfahren Alternativmedizin Altruismus Professor Dr.
Elmar Altvater Das Ende des Kapitalismus wie wir ihn kennen Alumni Amalfiküste
Ambient Music Ambiente Ambiguität Ambiguitätstoleranz Ambulanz Amerika Amore
Amour Insel Amrum Anamnese Anderwelt Andrew Newberg Anduze Anerkennung Anfang
Among Angels Angriff Angst Ängste Aniene Animus und Anima Anita Anliegen
Anorexie Anregungen Ansbach Antarktika Antarktischer Ozean Antipathie Antithese
Antworten 'ao'ao Lono Ku Kane Kanaloa Po Ao Apennin Apokryphen Apostel App
Appennini Approbation approbiert Apulien Arabisches Meer Arafurameer Arafurasee
Aralsee Aranyakas Ararat Arbeitsklima Arbeitslosigkeit Arbeitsplatzkonflikte
Arbeitsstörungen Arcade Fire Archetyp Archipel de Riou Argentinien Arktis
Arktischer Ozean Aroma Artemis Asana-Position Asanaprayoga The Ascent of
Humanity - The Age of Separation, the Age of Reunion, and the Convergence of
Crises that is birthing the transition Ashram Asien Askese Assessment Center
Astralleib Astralreisen Astralwelt Astrologie Astronomie Atem Atembeschwerden
Atemübungen Atharvaveda Atlantik Atlantischer Ozean Atlas Atma Vichara Atman
Atmosphäre Attraktivität Aude Audit Aufbruch Aufdecken Aufgeschlossenheit
Aufklärung Aufmerksamkeit Aufstand Aufstieg Aufwachen Auge Augen Augenblick
Augustinus 'aumakua Sri Aurobindo Ausbildung Ausdauer Ausfallhonorar Ausflug
Ausgangssituation ausgeliefert Ausland außerkörperliche Erfahrung
Aussichtsbalkon Aussichtsterrasse Australien Auswahlverfahren Autarkie
Authentizität Autogenes Training Automatisierung Autonomie Autopoiese

Autor Avebury Awake Awakening Axon

آيةAya āyat al-kursī
āyat an-nūr
Azoren-Hoch Baden

Badevergnügen Backcountry Flying Backcountry Pilot Bahai Bahn Bahnreisen

Bahnvergnügen Balearen Balearen-Meer Ballon Ballonfahren Balsam für die Seele
Balsamba Baltisches Meer La Bambouseraie d'Anduze Bammel Bandhas Barentsmeer
Barentssee Bauchgefühl Baum der Geduld Baum des Lebens Baumkuchen Bayern Beats
Beaufortmeer Beaufortsee Beauty Aaron T. Beck Don Beck Spiral Dynamics Klaus
Jürgen Becker Die Kraft der Selbstverantwortung Bedauern bedrückt Bedrücktheit
Bedürfnisaufschub Bedürfnisse Befinden Befindlichkeit beflügelnd Begabung
Begegnung Begegnungskreis Begeisterung Begleiterscheinungen Begrüßungsritual
Behagen Behandlung Bekannte Belletristik Belohnung Beltane Belvédère
Bengalisches Meer Beobachtung Beratung Beratungsteam Berge Beringmeer Beringsee
Berndt Albin Ebler Beruf Berufsausbildung berufsbegleitende Ausbildung
Berufseinstieg Berufsleben Berufung Besorgnis Bethlehem Betriebspsychologie
Beweis Bewerbung Bewertung Bewertungsmuster Bewertungssystem Bewerbungstraining
bewusste Lebensgestaltung Bewusstsein Bewusstseinswandel Beziehung Beziehungen
Beziehungsqualität Bezugspunkt Bezugsrahmen Bezugssystem Biblioteca Medicea
Laurenziana Bild Bilder Bilderberger Bildung Bildungslandschaft Bildungsreise
Binaural Beats Bindung Bindungsfähigkeit Bindungsstil Bindungstheorie
Biologische Psychologie Beats Beltane Bidean nam Bian bildende Kunst Bildung
Biographie biopsychosozial bird's eye view Biscaya bisexuelle Seele
Blickkontakt blickshirt Blimey Cow Messy Mondays Blüte Blütezeit Blume des
Lebens BND Bob Dylan Bringing It All Back Home Börse David Bohm book Boot I
Borghi Più Belli d'Italia Bormes les Mimosas Botschaft Boulder Creek Boykott
Bozava Brac Brahman Brahmanas Brainstorming Brainwave Entrainment Brandung
Breitengrad Brief des Hermes an Asklepius Britische Inseln Bruchstück einer
Rede von Asklepius an den König Bruder Klaus Brügge Bruges Brugge Buch
Buchstaben Buddha Buddhismus buddhistisch Bücher Bugarach Bulimie Burnout.
Caesar von Hofacker Calanques California
Campus Cantobre Canyon Capraia Capri Carcassonne Carl Albrecht Carl Sagan
Carmel Caroux Castel del Monte Catania Causses C.G. Jung Celestine Cervara di
Roma Cevennen Cévennes Chakim libba Chakra Chakren Chance Chancen
Chancengleichheit Change Chaos Chaos de Montpellier-le-Vieux Chaos de
Nîmes-le-Vieux Chaostheorie Charakter Charisma Danny & Charlie Charme
Belvédère du Chassezac Chemtrails Chiffre Chiffriermaschine Chillout Music
Chinesisches Meer Christentum christlich Christus chronisch chronische
Schmerzen Church CIA Cinque Terre Clemens von Alexandria Clint Mansell Club
City Cloud Seeding Clubreisen Coaching Code Coleman Barks Collioure Comedy
Community Computer Halbinsel Conero Consciousness Conspiracy Detection
Conspiracy Theory contemplatio Coping Copingrepertoire Copingstrategien
Corniche des Cévennes Corniglia Corporate Social Responsibility Corpus
Hermeticum Corse Cosimo de Medici cosmic consciousness CosmicRevolutionKS
Cosmos Côte d'Azur Courage La Couvertoirade covert action Creation Credit
Points Cres Critical Mass Crop Circles Cross CSR cveitch cymatics.
Dänische Inseln Dag Hammarskjöld Dalai Lama Dalmatien
Dankbarkeit Danny& Charlie Daodejing Daoismus Daoistische Mystik
Dardanellen Das Allgemeine Gespräch Das Größte Übel für die Menschen ist die
Unwissenheit in Göttlichen Dingen Das Gute ist Gott allein und nirgends
Anderswo Das Heilige Abendmahl Das Rote Buch Das Umgreifende Datenschutz Dating
David Lynch David Wilcock Dechiffriermaschine Defizit Deggendorf Demiurg
Demonstration Denkanstöße Denken Denkmuster Depression Depressionen Der Geist an
Hermes Der Heilige Gral Der Menschenhirte des Dreimal-Großen Hermes Der
Mischkrug oder die Eins Der Schlüssel Der Unbewegte Beweger Der verborgene Gott
ist völlig offenbar Derwisch Desensibilisierung Le Dessous des Cartes
Destinationen Deutsche Inseln Deutschland Deutschpop Deutschrock Dhikr
Dhikrullah Dhyanayoga diadrome Fische Diagnose Diagnostik Dialog Die Bundeslade
Die Heilige Rede Dies Natalis Solis Invicti Dimensionale Diagnostik Dimensionen
Diplom Diplom-Psychologe Diplom-Psychologin Disclosure Project Distanz Divine
Pymander Divinity DNA Dogma dogmatisch Dogmatismus Domain Domainhandel
Domainmarktplatz Domainverkauf Domizile Dopamin Dortmund Douch Dourbies Dover
Channel dreidimensional Dreieck Dreieinigkeit Dreifaltigkeit Drittes Auge
Drohnen Druck Dschalal ad-Din ar-Rumi Du Dubrovnik Hans-Peter Dürr Düsseldorf
Duft Dugi Otok Durchgangshöhle Durst Dvaita-Vedanta Dvijas Dysthymia. EAP
EarthApp Eber Echtheit Edgar Cayce Edinburgh Edition Egoseele Ehe Eichstätt
Eignungsdiagnostik Eindruck Einfälle Einfluss einflussreich Einheit Einpassung
einsam Einsamkeit Einsatzbereitschaft einseitige Hypothese (gerichtete
Hypothese) Einsicht Einsiedler Einssein Einstellung Einstellungsveränderung 21
einundzwanzig 21.12. Einundzwanzigster Zwölfter Einzelgespräche Einzeltherapie
Eisenbahn Charles Eisenstein Ekstase ekstatische Glückseligkeit Elba Elemente
Elektra-Komplex Albert Ellis Eltern Elternschaft E-Mail Emanation Emanuel
Swedenborg Emanzipation EMDR Emotion emotionale Intelligenz emotionale
Kompetenz emotionale Störungen Empathie Empfehlungen Empfindung Empirische
Forschung Employee Assistance Program Ende Endorphine Energie Energiefluss
Energieorte Energiezentrum Engagement Engel England Englisch Englischer Kanal
English Channel
αἴνιγμαEnigma Enlightenment Ensemble Ibn Arabi Entdeckung
Entdeckungsreise Enthusiasmus Entrümpelung Entschleunigung Entspannung
Entspannungsfähigkeit Entspannungsmusik Entspannungstherapie Enttäuschung
Entwicklung Entwicklungspsychologie Entwicklungsraum Entwicklungsstörungen
Ephesus Er ist Ich, Ich bin Er. Erblassen erblich bedingt Erdatmosphäre Erde
Eremit Eremitage Eremo di San Domenico Erfahrung Erfolg erfolgreich
Erfolgsaussichten Erfolgsorientierung Erfolgswahrscheinlichkeit Erfüllung
Ergotherapie Erholung Erinnerung Erkenntnis Erkenntnisreisen Erkenntnisspur
Erlangen Erlebnis Erlebnisatlas Erlebnisreisen Erlebniswelten erlernt erlernte
Erleuchtung Erlösung Muster Erlösungsweg Ernährung Ernährungsberatung
Ernährungspsychologie Ernen Eros Erotik erotisch erregend erregt Erregung Erregungsniveau
Erröten Erstbeweger erste Materie ersten Blick Erstis Erstsemester Erwachen
Erythrophobie Erzählung esprit de corps Essen Essener Essstörung Essstörungen
Ethik ethisch Etna Eugen Drewermann Eugene d'Aquili Euphorie EU Eurasien Europa
evangelisch Evangelium Events Everything is OK The Love Police Évora Existenz
Existenzialismus Existenzielle Reflexion Exkursionsseele Exosphäre Experiment
Experimentelle Psychologie Experimentierfreude Experte Expertin Expertise
Exploration Extraversion extravertiert extrinsisch Exzellenz Exzess. Facebook
Facharzt Fachärztin fächerübergreifend Fachkompetenz Fähigkeiten Fairness
Faktor Fünf - Die Formel für nachhaltiges Wachstum Fallschirmspringen familiär
familiäre Normen Familie Familienaufstellung Familiengründung Familienleben
Familienschutzgeist Familientherapie Familienzusammenhalt Fantasiereise
Faraglioni della Madonna Faraglioni di Calzo I Faraglioni di Maria Rosa I
Faraglioni di Mezzogiorno Favignana Fehlhandlungen Fehlleistung Insel Fehmarn
Feiern feinstofflich feinstoffliche Erweiterung unseres Weltbildes
feinstoffliche Ebene feinstoffliche Energie feinstoffliche Welt feinstofflicher
Körper feinstoffliches Erleben Ferien Ferner Osten Fernsehen Fertigkeiten Fest
Festhalten Feuer Richard Feynman Fibonacci-Folge Filicudi Filme Finanzen Una
Finnegan Firehose Fisch Fischland Darß und Zingst Fiumicino Fixierung
Flash-back Flexibilität Fliegen Flirt Flirten Flourish Flow Flower of Life
Flowerleben Paradigm Shifting Flowetry Flugausbildung Flughafen Flugplatz
Flugreisen Flugsimulator Flugzeug Fluss Flussreisen Flyer Fokaltherapie Fokus
Förderung Formbildungsursachen Fortschritt Forum Fotograf Fotografie Fotos
Fragen Fragment fragmentarisch Fraktalgeometrie Frankreich Französisch
Französische Inseln Max Freedom Long Frei Freie Energie Freie Assoziation
Freiheit Freiheitsgrade Freiheitskampf Freiseele Freizeit Freizeitaktivitäten
Freizeitforschung Freizeitpsychologie Fremdsprachen Frequency Frequenz Freud
Freude Freund Freunde Freundeskreis Freundin Freundinnen Freundlichkeit
Freundschaft Friede sei mit euch, Freunde! Friede, Friede! Frieden Friedrich
Weinreb Frustration Frustrations-Aggressions-Hypothese Frustrationstoleranz
frustrieren frustriert FSB Fügung Fühlen Führung

Führungseigenschaften Führungspersönlichkeit Führungsstärke Führungsstil fünf
Elemente 5125 Fuerteventura fundamental fundamentaler Attributionsfehler

Funken der Erleuchtung Fusion. Gaeta Galaxie Galaxienhaufen Galaxy Galerie

Gallo Lungo Ganges Ganzheitlichkeit Gard La-Garde-Guérin Gardon Gargano Garten
Eden Gauß Gebirge Geborgenheit Gebot Jean Gebser Geburt Gedächtnis
Gedächtnistraining Gedanken Gedankenaustausch Gedankenbild Gedankensammlung
Gedicht Gefühl Gefühlsklärung Gefühlskonsequenz Gefühlsleben Gefühlswelt
gefühlvoll Gegenkonditionierung Gegenübertragung
αἴνιγμαgeheim Geheimbund Geheimgesellschaft
Geheimnis Gehirn Geist Geist eines verstorbenen Verwandten geistig geistlich
Gelassenheit Gelassenwerden Gelbes Meer Geld Geldanlage Gelingen Gemälde
Gemeinschaft Gemeinschaftsgefühl Gemeinschaftsorientierung Generalisierung
generische Begriffe genervt Genesung Genetik Geniertheit Genießen Genitale
Phase Genoa Genova Genua Genuss Genussfähigkeit Geo Engineering Geheimdienst
Gerechtigkeit Gershom Scholem Geruch Geruchssinn Geschäft Geschichte Geschmack
Geschmackssinn Gesellschaft gesellschaftliches Engagement Gespräch
Gesprächstherapie Gestalttherapie Gestaltungstherapie Gesundheit
Gesundheitsförderung Gewalt Gheranda Gherandasamhita
धेरंडसंहिताGiannutri Giglio Gikatilla
Giordano Bruno Gipfel Giraglia Gläserner Bürger Glauben Glaubenssätze
Glaubensvorstellungen Gleichgesinnte Gleichgültigkeit Glen Coe Glencoe Glück
Glücksfähigkeit Glücksfaktoren Glücksforschung Glückwunsch Gnosis Gnostiker God
Godfrey Reggio göttlich Göttliches Selbst Goldener Schnitt Goldinseln Goldjunge
Golf von Bengalen Golf von Biscaya Golf von Lyon Golf von Lion Golfe du Lion
Golf von Mexiko Golf von Neapel Golfo dei Poeti La Gomera Google Earth Google
Maps Gorges Gorgona Gott Gottesbeweis Grächen Gran Canaria Klaus Grawe
Konsistenztheorie Great Transition Green Economics Green New Deal Greenwashing
Gregg Braden Griechische Inseln Großbritannien Größenfantasien Größenideen
Großstadt Grundbedürfnisse Grunderregungsniveau Gruppen Gruppendynamik
Gruppengespräch Gruppenreisen Gruppentherapie GT Güte Gütekriterien Gustave Le
Bon. Habituation Hadith Hafen Hafenstadt Halbinsel Hallig Haltung hamsa Hand
Hände Handlung Handy Harndrang Andrew Harvey Hass Hathapradipika
हठप्रदिपिका Hatha-Yoga Hathayogapradipika
Hauchseele Hawaii hawaiianischer Schamanismus Heartmath Institute Heaven
Hedonismus Heidentum heilig Heilige Geometrie Heilige Berge Heilige Orte
Heilung Heiterkeit Hérault Herausforderung Hermes Trismegistos Hermes der
Dreimal-Große an Asklepius Hermes der Dreimal-Große an Tat Hermetic Hermetik
Herz Herzensruhe Herzensweisheit Herzrasen Herzstiche Herzzentrum Bill Hicks
Hidden Beach Hidden Canyon Hidden Lake Insel Hiddensee Hier und Jetzt Hierro
Kurt Hiller Himalaya Himmel Hindu Hinduismus hinduistisch Hinduistische Mystik
Hingabe Hip Hop Hobbies Hochbegabung Hochschule Hören Hoffnung Hoffnungsfunken
Hoffnungsschimmer Höheres Selbst Höhlengleichnis Hörsaal Hohes Selbst Hohn Jan
Udo Holeyholotrop Holotropes Atmen Homepage Homonymie hongi Hoʻoponopono
Horizont Horus Hotels Hudson Bay Hügeldorf Hügelstadt Hüter-Bewusstsein
Hütergeist Hüter-Geist Hüter-Mem Humanismus Humanistische Psychologie Humanität
Humanity Humanity Healing Human Resources Human Resource Management
Humboldtsches Bildungsideal Humor Huna Hunab Ku Huna-Gebete Hunger Hypnose
Hypomanie Hypostase Hypothese der formgebenden Verursachung Hypothesen
Hysterie. Ian MacKenzie I Faraglioni Ibiza Ibn Arabi Ich Ich-Bewusstsein
Ich-Ideal Ich-Psychologie IchTour Ich-Verlust Ideale Idealisierung Idealismus
Ideen Ideenflüssigkeit Identifikation Identität Identitätsentwicklung
Identitätskonflikt Il Faraglione Île de la Pietra Île de Porquerolles Île de
Porri Île de Port-Cros Île de Riou Île Sainte-Marguerite Îlot Saint-Feréol Îlot
de la Tradelière Île Saint-Honorat Îles Cerbicale Îles du Frioul Île du Levant
Îles Lavezzi Île San Ciprianu Îles de Lérins Îles d'Hyères Îles Sanguinaires Il
Galli Illumination Illuminismo Îlot de Capense Imagination Imaginative
Verfahren Imam Imbolc Improvisation Improvisationsfähigkeit Impulse
Impulskontrolle Indien Indik Indischer Ozean Individualismus Individualreise
Individuation Informationen Initiation Initiative innen Innenschau Inner Circle
innere Bilder Innerer Kreis Inneres Kind Inneres Selbst Insidertipps
Inspiration inspirierendes kollektives Hüter-Feld Instinkt integrale
Marktwirtschaft Intellekt intelligent Intelligenz Intelligenzminderung
Intelligenztest Interaktion interdisziplinär Interesse Intervention Interview
Intervision Intimität Intimitätsentwicklung intrinsisch Introjektion
Introspektion Introversion Intuition intuitiv interkulturell interkulturelle
Kompetenz interkulturelles Lernen Internet Intervention Introspektion Invention
Inventur Investigativer Journalismus

Invincible Sun Ionisches Meer Ionosphäre Ireland Irland irreversibel Isaac

Isaak Luria Ischia Islam islamisch Island Isola Abbatoggia Isola Asinara Isola

Barca Sconcia Isola Barrettini Isola Budelli Isola Cana Isola Capicciolu Isola

Cappuccini Isola Capraia Isola Caprera Isola Carpa Isola Cavalli Isola Corcelli

Isola dei Cavoli Isola dei Conigli Isola dei Ratti Isola del Campo Isola del

Cavallo Isola del Coltellazzo Isola del Corno Isola della Malva Isola della

Testa Isola delle Bisce Isola delle Rocche Isola dell'Ogliastra Isola di Campi

Isola di Figarolo Isola di Gavi Isola di Mal di Ventre Isola di Mezzo Isola di

Nisida Isola Dino Isola di Quirra Isola di San Pietro Isola di Sant'Antioco

Isola di Santo Stefano Isola Ferraglione Isola Forte a Mare Isola Genio Isola

Giardinelli Isola Grande Isola Il Cretaccio Isola La Chianca Isola La Chiesa

Isola La Presa Isola Maddalena Isola Manna Isola Molara Isola Mortorio Isola

Municca Isola Padiglioni Isola Patron Fiaso Isola Piana Isola Portisco Isola

Proratora Isola Razzoli Isola Rossa Isola Ruia Isola Ruja Isola San Domino

Isola San Macario Isola San Nicola Isola San Stefano Isola Sant'Andrea Isola

Santa Maria Isola Serpentara Isola Soffi Isola Spargi Isola Spargiotto &

Spargiottello Isola Su Cardolinu Isola Su Giudeu Isola Traversa Isolation Isola

Tavolara Isola Tuarredda Isole dei Poveri Isola Del Toro Isola La Vacca Isola

Vivara Isole di Portolucas Isole I Variglioni Isole Le Camere Isole Marmorata

Isole Nibani Isole Pedagni Grandi Isolotti Barrettinelli Isolotti di Cala Lunga

Isolotti Paduleddi Isolotti Stramanari Isolotto dei Pedrami Isolotto d'Ottiolu

Isolotto Rosso Israel Istrien Isuli Lavezzi Italien Italienisch Item. Jacobson

Jadransko More Jahresrad Jakob Böhme Jakob Lorber James H. Austin Teilhard de
Jardin Jean Gebser Jenne Jerusalem Jesus Jetzt Jezira Die Seele (jiva) tritt
mit der Silbe ha aus und mit der Silbe sa ein. So wird gesagt, dass sie
beständig das Mantra hamsa ausspricht. Jnana Job Enlargement Job Enrichment Job
Rotation Jochanan ben Sakkai Johannes-Evangelium Johannes Heinrichs
Johari-Fenster John Bell Joint Venture Jordanien Journey Into Self Judentum
jüdisch Jugend jugendlich Jul Julfest Julia Juliane von Krüdener Jung
Jungbrunnen Jungfernfahrt Jungfernflug. Kabarett Kabbalah Kabbalistik Serge
Kahili King Kahuna Kahunas Morrnah Simeona Kala Kalifornien Kälte Kampagne
Kampf Kanalinseln Lono Ku Kane Kanaloa Po Ao Kanaren Kanarische Inseln Lono Ku
Kane Kanaloa Po Ao Kap Kapitalismus Kapitalismuskritik Kaprije Kapverden
Kapverdische Inseln Karameer Karasee Karibik Karibische Inseln Karibisches Meer
Karin Karl Jaspers Karl Rahner Karmel Karriere Kaspisches Meer Kastrationsangst
Kategoriale Diagnostik Kategorie Kate Bush 50 Words For Snow Among Angels
Katharer Katharsis katholisch Kattegat Kauai Kausalattribution Keilschrift Keim
Keimenergie Keimkraft Keimwachstum Kennenlernen Kensho Kernessenz Kernschemata
Key Kinderseele Kino Kirche Kirchengeschichte Klassifikation psychischer
Störungen Klarheit Klärung Klassische Konditionierung Klassische Musik
Klaustrophobie Kleidung Klient Klienten Klientenzentrierte Psychotherapie
Klientin Klientinnen Klima Klinik Klinische Psychologie Know-How Körperwelt
Kontemplation kontemplativ kontemplativer Orden Kontinent Koran Körper
Körperbewusstsein Körpergefühl Körperschmerz Körperseele Kognitionen
Kognitionspsychologie kognitiv Kognitive Dissonanz Kognitive Umstrukturierung
Kognitive Verhaltenstherapie Kognitive Verzerrungen Kohärenzgefühl Kollege
Kollegin Kollektive Intelligenz Kollektives Unbewusstes Kollektivismus
Kollusion Kommentar Kommunikation Kommunikationstraining Kompensation
Kompetenzen Kompetenznetzwerk Komplex Kompliment kompliziert komplizierte
Persönlichkeit komplizierte Trauer konditionierte Reaktion konditionierter Reiz
Konditionierung Konfabulation Konfession

Konfidenzintervall Konflikt Konfronation Konfrontationstherapie Kongruenz

konkret konkrete Kunst Konkretion Konstruktivismus Konsum Konsumkritik Kontakt

Kontaktaufnahme Kontaktbedürfnis Kontaktdaten Kontaktformular

Kontaktmöglichkeit Kontext Kontinente Kontrolle Kontrollüberzeugungen

Konventionen konventionell Konversion Konzentration Konzepte konzeptuelle

Arbeiten Konzert Kooperative Evolution Koordinaten Kopf Kopfschmerzen Kopfstand
Korallenmeer Korallensee Korfu Kornkreise Korrelation Korsika Kortex Kos
Kosmologie kosmologisch kosmopolitisch Kosmos Kostenerstattungsverfahren
Koyaanisqatsi Kraft Kraftorte Kraftquellen Krampf Krankenkasse Krankheit
Krankheitsgewinn Kreativität Kreislauf Kreislaufstörungen
Kreislaufzusammenbruch Kreta Kreuz Krise des Kapitalismus Kritische Masse
Kritische Psychologie Trier Kriya
क्रिया Kriya Yoga Kriyas Krka Kroatien Kroatische Inseln Kronenchakra
kryptisch Kryptographie KT Lono Ku Kane Kanaloa Po Ao Küche Küste kulinarisch
kultiviert Kultur Kulturangebot kulturell Kulturelle Normen Kulturbildung
Kulturgenuss Kulturprogramm Kulturpsychologie Kummer Kumupa'a Kunsttherapie
Küste Kundalini
कुण्डलिनीKundalini-Schlange Kundalini-Yoga Kvarner Bucht KVT Kybalion
Kykladen Kymatica. La Grande Bleue Lac des Pises Lachen Lachtherapie Lactantius
Lächeln Längengrad Laden Lage Lagos Lagrasse Land und Leute Länder Lampedusa
Lampione Langsamkeit Languedoc-Roussillon Lanzarote Laozi La Rotonda
Latenzperiode Latenzphase Latium Lavezzi Lazio Leben Lebensatem Lebenserfahrung
Lebenserwartung Lebensfreude Lebensgefühl Lebensgeschichte Lebensgestaltung
Lebenshälfte Lebenskunst Lebenslage Lebenslauf Lebenslust Lebenspartnerschaft
Lebensqualität Lebenssituation Lebensscripts Lebensskripts Lebensstil
lebenswert Leere Leerheit Lehre Leib leiblich Leidenschaft Le Isole Egadi Le
Isole Eolie Le Isole Tremiti Leistung Leistungsbereitschaft Leistungsfähigkeit
Leistungsmotivation Victoria Lemle Beckner Monti Lepini Lerici Lernen Lernen am
Modell Lernzielhierarchie Levanzo Li Galli Libido libidinös Licht Peter Licht
Lieder vom Ende des Kapitalismus Wir werden siegen - Buch vom Ende des
Kapitalismus Lichtfunken Lichtkörper Lichtperiode Lichtstrahl Lichtstreifen
Lichtvers Liebe liebenswert Liebesbeziehung Liebeswahn liebevoll Liguria
Ligurien Ligurisches Meer Limited Reparenting Michael Linden Lineares
Denkmodell Montagne du Lingas Linosa Lipari Liparische Inseln Lissabon Livata
live livello del mare Lobbyismus Loge Logen Logik logisch Logos Logotherapie
London Lono Ku Kane Kanaloa Po Ao Look to the source / Nānā i ke kumuLoslassen
Lösungsmöglichkeiten lösungsorientiert Lösungsorientierung Lou Reed Magic And
Loss NYC Man Lounge Music Love Mont Lozère Ludwig Wittgenstein Luft Luftbild
Als Luftlinie bezeichnet man die kürzeste Entfernung zweier Punkte
in der Landschaft über den direkten Luftweg durch eine Strecke. Luftlinien
verlaufen stets parallel zur Erdoberfläche. Bei größeren Entfernungen ist die
Kugelgestalt der Erde zu berücksichtigen. In der sphärischen
Trigonometriebewegt man sich dann entlang von Kreisbögen, deren Mittelpunkt der
Erdmittelpunkt ist (sog. Großkreise). Bei der Projektion solcher Strecken auf
ebene Karten entstehen im Allgemeinen keine Geraden mehr, sondern Kurven, die
aber immer noch den kürzesten Abstand zwischen zwei Punkten repräsentieren. In
der Geometrie und der Navigation spricht man daher präziser von der Orthodrome
statt von einer Luftlinie. EineKartenprojektion, bei der Großkreise (und damit
die „Luftlinien“ zwischen zwei Punkten) stets als Geraden abgebildet werden,
ist dieGnomonische Projektion.
Lughnasadh Lux Aeterna
Lux Invictus Luzider Traum Lyrik. Macht Machtmissbrauch Machtstreben Madagaskar
Madeira Tour de Madeloc männliche Apostel Magersucht Magic Magick Magie Magier
Magierin magisch Magische Orte magisches Denken magisches Handeln Mahabharata
Ramana Maharshi Mahayana Maimonides Malchut Malerei Mallorca Malta Mana
Mana-Fluss Management Managementtraining Manager Managerin Manarola Mandala
Manie Manifestation manifester Trauminhalt Manipulation manisch-depressiv Mario
Mantese Mantra
मन्त्र Mantras
Manuskript Mare Mediterraneo Marettimo Marketing Markt Marktführer Marktmacht
Marktplatz Marmarameer Marokko Marseille Marsilio Ficino Martin Buber Martin
Luther Martinscica Massenerhebung Massenpsychologie maßgeschneidert Matera
Matrix Mauerfall Max Planck maya Maya McKinleyville Median Mediation Medien
Meditation Mediterranean Sea El Mediterráneo Medium Medizinische Psychologie
Meer Meer von Okhotsk Meister Eckhart Mem Memmingen Mens ad mercurium
Menschenführung Menschheit menschlich menschliche Güte Menschlichkeit Mentoring
Méditerranée Meeresspiegel La Mer Mercurii ad Aesculapium Mercurii ad
Aesculapium sermo universalis Mercurii ad Tatium crater sive monas Mercurii ad
Tatium de communi Mercurii Ad tatium Filium suum Mercurii ad tatium Filium suum
de generatione & impositione silentii. Quod deus Latens simul ac patens
est. Mercurii sermo sacer Mercurii Trismegisti clavis ad Tatium Meridian Merkel
verkauft Waffen Meru Foundation Mesa Mesopause Mesosphäre Message Messias
Metabewusstsein Metaphern Metaphernreise Metropole Michael A. Persinger
Michaeli Karin Migräne Missbrauch Misstrauen Mit Einer Stimme Mitarbeiter
Mitarbeiterführung Mitarbeitermotivation Mitgefühl Mitglieder Mitgliedschaft
Mithras Mitleid Mitte Mittelmeer Mittelwert Mnemotechnik Mobbing Mobilität
Modelllernen Modus Möglichkeiten Mohammed Molarotto Monotheismus monotheistisch
Mont Mont Aigoual Monte Autore Monte Montecristo Monterosso al Mare Monti Mo
'olelo Mount Moral Moralischer Kapitalismus Moralvorstellungen
morphic fields morphische Felder morphogenetische Felder Morrnah Simeona Mosel
Motiv Motivation Motivationstraining Mountain Top Airport Mount Everest
Mudraprayoga Mudras müde Müdigkeit Mund Michael J. Murphy Musik Muskeln
Muskelspannung muskulär Muspilli Muster Mut Mysterienkulte Mystica Mystik
Mystische Erfahrungen Mystische Erlebnisse Mystische Orte Mystisches Erleben
Mystizismus. Nachhallpsychose Nachhaltiges Wirtschaften Nachhaltigkeit Nafs
Nähe Naher Osten Nahtoderfahrungen Name Nānā i ke kumu / Look to the source
Nanotechnik Nanotechnologie Napoli Naqoyqatsi Narkolepsie Narzissmus
narzisstische Persönlichkeitsstörung Nase Nationalparks Natur
Naturheilverfahren Naturparks Neapel Nebenmeer Nectar Nektar Neologismen Nepal
Nervi Network Netzwerk Neuanfang Neubeginn Neuplatoniker Neuplatonismus
Neurasthenie Neuroleptika Neurolinguistisches Programmieren Neuseeland New York
City Neurologie Neuroplastizität des Gehirns Neuropsychiatrie Neuropsychologie
Neuropsychotherapie Neurose Neurotische Störungen Neurotransmitter Neuseeland
New Age New World Newcastle-upon-Tyne Nice Nichts geht verloren von Allem, was
ist: die Menschen irren, wenn sie Umwandlung Untergang und Tod nennen
niedergeschlagen Niedergeschlagenheit Niederländische Inseln Nihil eorum Quae
sunt interitus sed mutationes: Decepti Homines interitum nominant Niklas
Luhmann Niklaus von Flüe Nikola Tesla Nikolaus von Kues Nîmes The 9 Intense
Experiences Nirvikalpa Samadhi Nirwana Niveau Nizza NLP Nördlicher Ozean
Nordamerika Nordatlantik Nordatlantischer Ozean Insel Norderney Nordkalifornien
Nordmeer Nordostengland Nordpazifik Nordpazifischer Ozean Ozeanien
Nordpolarmeer Nordrhein-Westfalen Nordsee Norm Norma normal Normalität
Normalverteilung Normen Norwegische Inseln Norwegisches Meer Nostradamus Nous
Nullmeridian Numana Bill Nye. Oberpläne Objekt Objektbeziehung
Objektbeziehungstheorie objektiv Objektivität ödipal Ödipuskomplex Ökumene
Offenbarung Offenbarungen Mit offenen Karten Ohnmacht ohnmächtig Ohr Ohren
Ohrensausen Ökologie Ökologisierung des Kapitalismus Everything is OK The Happy
Carriage Okzitanisch olfaktorisch Om Omar Faruk Tekbilek
Ὂ μέγα Omega
Omnipotenzgefühle online online Dating online Portal Ontologie Operante
Konditionierung Operationalisierung Opposition Opus Dei Optimierung Optimismus
optimistisch optisch Orangerie Orb Orbit Orchidee Orchideenfach Orden
Organische Störungen Organisches Psychosyndrom Orgasmus orgastisch Orgon
Orientierung Orientierungsvermögen orphisch Orsigna Ort Ortsmarke
Ostchinesisches Meer Ostfeste Ostsee
אותOt Otok Ozean Ozeanclub Ozeangefühl Ozeanien Ozeanische
Mythologie OzeanParty OzeanSeminare OzeanVoyage Ozon. Pacing Paganismus Palermo
Palmarola La Palma Palmen Panarea Panik panisch Pantano Grande Pantelleria
Pantheismus pantheistisch Pantheon Paradies paradiesisch Paradiesorte Paradigma
Paradigmenwechsel Paranoia paranoid Parapsychologie Pareto-optimal Paris
Particles Partikel Partisanen Partnerprogramm Partnerschaft
Partnerschaftsprobleme Partnerschaftsqualität Partnersuche Partnerwahl Party
passiv-aggressiv Patanjali Patchwork-Familie Patientenrolle Pavor nocturnus
Pazifik Pazifischer Ozean Penisneid Persien Persische Mystik Persischer Golf
Person Personensuche Personalauswahl Personalberatung Personalentwicklung
Personalführung Personalwesen Persönlichkeit Persönlichkeitsakzentuierung
Persönlichkeitsentwicklung Persönlichkeitspsychologie Persönlichkeitsstörung
Persönlichkeitstypologie Persönlichkeitswachstum Perspektive Perzentil Peter
Fenwick Peter Fuchs Pfarrer Pfarrerin Phänomenologie phänomenologisch
Phallische Phase Phallussymbol Phantasiereise Pharmaindustrie Pharmalobby

Pharmavertreter Phil Osophical Philosophie Phobie Phobien Photos Photographie
Physik Pi Piana di Mezzo Pianosa Pic Piko-Piko Pilot Pilotin Pimander Pin
Daniel Pinchbeck 2012: Time for Change Sting David Lynch Ellen Page Paul
Stamets Gilberto Gil Shiva Rea Tiokasin

Ghosthorse Michael Dorsey Ganga White Barbara Marx Hubbard Bernard Lietaer

Terence McKenna Michael Coe Curt Collier Maude Barlow Gaspar Pedro Gonzalez

Andre Soares & Lucy Legan Nassim Haramein Mitch Horowitz Michael Jantzen
Ken Jordan Kathi von Koerber Joel Kovel Dennis McKenna Donald McPherson Dean
Radin John Perry Barlow Richard Register Joe Rogan Douglas Rushkoff DJ Spooky
Penny Livingston-Stark John Todd Ryan Wartena Craig Westcott Inger Yancey Maharishi
Mahesh Yogi Pineal Gland Pinnwand Pioniergeist Pizzomunno Placebo Placemark
Plakate Plan Plananalyse Planet Platon platonische Ideen Platonismus Plattform
Nationalpark Plitvicer Seen Po Lono Ku Kane Kanaloa Po Ao po aumakua
Gemeinschaft der Hohen Selbste po
´ko´i Zauberer pochendes Herz Podcast poem Poemander Poesie
Polarmeer Politische Psychologie Polysemie Polytheismus polytheistisch
Polytoxikomanie pono Güte Rechtschaffenheit Sittlichkeit Moral Ethik ponopono
Ponza Powaqqatsi Pool Pop Portal Porto Portovenere Portugal Positano positive
Korrelation Positive Leadership Positive Psychologie positive
Wertschätzung/Anerkennung/Zuwendung Post Postkapitalismus potent Potenz
Potenzialentfaltung Potenzialentwicklung PPiA Pracchia Praktika Praktikum Prana
Pranayama Pranayamaprayoga Pratyahara Pratyaharaprayoga Praxis Predigt Preis
der Könige Priester Priesterin primärer Krankheitsgewinn Prioritäten Prisma
Proband Probandin Problemaktualisierung Problembewältigung Probleme
Problemlagen Procida Prodromalstadium Profession professionell Profil
Profitstreben Progressive Muskelrelaxation Projektion projektive
Identifizierung projektive Verfahren Prokrastination Prophet Prophetie
Prophetin prophetisch Prophezeiung

Protuberanz Provence Psalmen Psi Psychedelische Musik Psychiater Psychiaterin

Psychiatrie Psychiatrische Krankheiten Psychische Krankheiten Psychische

Probleme Psychische Ressourcen Psychische Störungen Psychische
Traumatisierungen Psychoanalyse Psychodrama Psychodynamische Theorien
Psychologe Psychologie Psychologie der Massen Psychologie des foules
Psychometrie Psychopharmaka Psychopharmakotherapie Psychophysiologie Psychose
psychotisch psychosozial Psychosomatische Reha Psychosomatische Störungen
Psychosynthese Psychotherapeut Psychotherapie Psychotherapie Informationsdienst
Psychotherapie-Begleitung Psychotherapie-Nachsorge
Psychotherapie-Wartezeit-Überbrückung Psychologische Psychotherapie
Psychologischer Psychotherapeut Pula Pulheim Puls Pulsar Puzzle Pymander
Pyrenäen Pyrénées-Orientales. Qi Gong Qualität Qualitätsmanagement
Qualitätssicherung Quanten Quantencomputer Quantenheilung Quantenmechanik
Quantenphysik Quantensprung Quantentheorie Quantum Quantenpsysik Quartile
Quartilsabstand Quasar Quelle Quetzlacoatl Schriftrollen von Qumran Quod in
solo deo bonum est alibi vero nequaquam Quod summum malum hominibus ignorare
deum. Rabbi Akiba Rabbiner Radio Ragnarök Rahima Warren Raja Yoga Randmeer
Randomisierung Paul Raskin Rat Rationalisierung Rauhnächte Reaktionsbildung
Realitätstest REBT Rechtsfragen Rede des Asklepius an König Ammon Redekunst
Redewendungen Referat Reflexion Reframing Regionen Regression Regulation des
Selbstwertgefühls Reha Rehabilitation Reha-Nachsorge Recruiting Redensarten
Redewendungen Reformation Reformen Regenbogen Regensburg Regierung Register
Registrierung reif Reife Reifung Reim Reincarnation reines Bewusstsein
reinforcement Reinigung Reinigungsprozesse Reinigungsübungen Reinkarnation
Reise Reiseclub Reiseerleben Reisefotografie Reiseideen Reiseleiter
Reiseleitertipps Reiseleitung Reisemotive Reisepartnerschaft Reisepartnersuche
Reisephilosophie Reisephotographie Reisepoesie Reisepsychologie Reisesimulator
Reisestil Reiseunternehmen Reiseveranstalter Reisevideos Reisewelt Reiseziele
Reize Reizüberflutung Rekonstruktion Relaxen Reliabilität Religion
Religionsphilosophie Religionspsychologie religiös Religiosität Die Renaissance
der Menschheit - Über die große Krise unserer Zivilisation und die Geburt eines
neuen Zeitalters Repräsentation Repräsentationssystem Repression
Residualzustand Resilienz Résistance Ressourcen Ressourcenorientierung RET
reversibel Reversion The Revolution Is Love REVT Rezitation Rhein
Rheinland-Pfalz Rhetorik Rhodos Riechen Rigveda Rijeka Riomaggiore Rishis
Risiko Risikobereitschaft Ritual Rocca Massima Rock Carl Ransom Rogers Rolle
Rollenerwartungen Rollenstress Rollenverhalten Rom Roma Roman Romantik
romantisch Roquebrun Rorschachtest Rose Rosecrucians Rosenkreuzer Rotes Meer
Routenplaner Rtanj Rubrik Ruck Rudolf Insel Rügen Rumi Rumination Runen. Saat
Sabbat Sacro Specco Sachbuch Sachkompetenz Sachverzeichnis Sacred Activism
Sacred Economics - Money, Gift & Society in the Age of Transition Sacred
Geometry Sahaja Yoga Saint-Guilhem-le-Désert Saint-Sauveur-Camprieu Sakarun
Salina Salutogenese Samadhi Samadhiyoga Samaveda Samhain Samhitas Samos San
Benedetto Santuario della Montagna Spaccata Sardegna Sardinien Satchakrabedha
Satori Satsang Saturnalien Schabbat Schalom Scham Schamanismus Schatten
Schattenarbeit Schatzsuche Schatztruhe Schechina Schema Therapy Schemaanalyse
Schemata Schematherapie schematisch Schicksal Schicksalskräfte Schiff
Schiffsreisen Schimon ben Jochai Schiss Schizoaffektive Störung schizoid
Schizoide Persönlichkeitsstörung Schizophrenie Schlafstörungen Schlangenkraft
Schizophrenie Schizotype Persönlichkeitsstörung Schlaf Schlafphasen
Schlafqualität Schlafstörungen Schlagwort Schloss Schlüssel Schlüsselwort
Schlussfolgerungen Schmecken Schmerzen Schmiergelder Schnorcheln Schönheit
schöpferisch Schöpfung Schottland
αἴνιγμα schreiben Schrift Schriftrollen von Qumran
Schriftzeichen Schüchternheit Schuldbegriff Schule Schwächen Schwarm
Schwarmintelligenz Schwarze Liste der Großkonzerne Schwarzes Meer Schwedische
Inseln Schwimmen Schwindelgefühl Schwitzen Scogli de Piscadeddus Scogli del
Felce Scogli della Cantina Scogli di Apani Scogli Mortorietto Scoglio del
Monacone Scoglio della Colombaia Scoglio di Aniello Antonio Scoglio di Monte
Russu Scoglio di Peppino Scoglio di Portonuovo Scoglio Il Morto Scoglio Isca
Scoglio L'Agusteri Scoglio Montagnello Scoglio Munichedda Scoglio Pan di
Zucchero Scoglio Ravia Scoglio Rosso Scoglio San Martino Scoglio San Stefano
Scoglio Su Brecconi Scoglio Vetara Le Scoglitelle Scotland 6.666 6.236 Secret
See Seele Seelenlehre Seelenverwandte Seelenwanderungslehre Seelische Gesundheit
Segni Sehen Sehnsucht sekundärer Krankheitsgewinn Sekten Selber machen wollen
Selbstachtung Selbstaffirmation Selbständigkeit Selbstbestimmung
Selbstbewusstsein Selbstbild Selbsteffizienz Selbstentwicklung Selbsterfahrung
Selbsterfahrungsreisen Selbsterforschung Selbstergründung Selbsterkenntnis
Selbsthilfe Selbstkenntnis Selbstkonzept Selbstmanagement Selbstmord
selbstsicher Selbstsicherheit Selbstsicherheitstraining Selbstsystem
Selbstunsicherheit Selbstunsichere Persönlichkeitsstörung Selbstvertrauen
Selbstverwirklichung Selbstwerdung Selbstwert Selbstwertbestimmung
Selbstwerterhöhung Selbstwertgefühl Selbstwertkonzept Selbstwertmanagement
Selbstwertmaßstab Selbstwertregulation Selbstwertreisen Selbstwertsteigerung
Selbstwertpsychotherapie Selbstwertschatz Selbstwerttraing Selbstwerttherapie
Selbstwirksamkeit Selbstwirksamkeitserwartung self efficacy Seligman Martin
Seminare Seminarraum Sensiblität Sephiroth Sermoneta Server Sexualität Sexuelle
Schwierigkeiten Shalom

, שלום חורים,שלום חורים

! שלום,שלום

, להתרות,להתרות

(2x) ! שלום,שלום

Shalom chaverim, shalom chaverim, shalom, shalom! Lehitraot, lehitraot, shalom,

shalom! Shasta Shatkarmasadhana Rupert Sheldrake Shift of Consciousness Danny
Shine Shiva Shodhana Shop Shopping Shruti Shuddhadvaita Šibenik sicher
Sicherheit Sichtweise Sid Sieb des Eratostenes Siècle des Lumières Silberstreif
am Horizont Simbruini Morrnah Simeona Singlebörse Singlereisen Sinn Sinne
Sinnenfreude Sinnerleben Sinngefühl Sinnlichkeit Sirince Sirius Sirolo
Situation situativ Sizilien Skagerrak Skype Smartphone Smriti Social Network
Social Psychology Soft Skills Soham
सोऽहम् Sohar Sol Invictus solar solidarisch Solidarische Moderne
Solidarität Solstice Solstitium Somatisierung Sommersonnwende Sonne
Sonnenschein Sonnenstrahlen Sonnensturm Sonnensystem Sonnenuhr Sonnenwind
Sorgen sozial Soziale Kompetenz Soziale Kontrolle Soziale Normen Soziales
Kompetenztraining Soziales Netzwerk Sozialmedizin Sozialpsychologie
Soziotherapie Souvenir Space Spaltung Spanien Spanisch

Spanische Inseln Spannung Spaß Spektrum Sperlonga Spirale spiritual activism

spirituell Spirituelle Marktwirtschaft Spiritueller Aktivismus Split
Sportpsychologie Sprache Sprachen Sprachenlernen Sprachtraining What In The
World Are They Spraying? Why In The World Are They Spraying? Sri Lanka
Staatsexamen Stabilität Stadt Stan Tenen Standardabweichung Stärken Stardust
stars Statistik Stellenangebote Sterben

Sterne Sternenstaub Steve de Shazer Worte waren ursprünglich Zauber Von der

Problemsprache zur Lösungssprache Steven T. Katz Stille Stimulation Störungen

durch psychotrope Substanzen Stichprobe Stichwort Stichwortregister
Stichwortverzeichnis Stille Stiller Ozean Stimmung Stoizismus Stolz Stonehenge
Strahlen Strand Stratopause Stratosphäre Streik Stress Stringtheorie Stromboli
Studienanfänger Studienanfänerinnen Studienanfang Studienbeginn Studienort
Studienreise Studenten Studentinnen Studie Studierende Studium Su Scoglieddu Su
Scogliu Mannu Subjekt subjektiv Subiaco Sublimierung Subtropen subtropisch Suchbegriff
Suchwort Suchmeldung Sucht Suchtverlagerung Südafrika Südamerika Südatlantik
Südatlantischer Ozean Südchinesisches Meer Süden Südeuropa Südfrankreich
Süditalien Südlicher Ozean Südmeer Südpazifik Südpazifischer Ozean Südpolarmeer
Südsee Sufi Sufismus sufiyya Suggesition Suizid suizidal Summer Sun Sunshine
Supernova Supervision Suren Susan O'Kieffe Sustainability Svatmarama Insel Sylt
Symbole Symbolisierung Sympathie Synästhesie Synchronictiy Synchronizität
Syndrom Synectics Synektik Synergie Synergieeffekte Synergie-Forum
Synergiewirkung Synkretismus Synthese Systemische Therapie Systemwandel.
Tagesklinik taktil Talent Talmud La Tamarissière Tanztherapie Taoismus
Taxonomie Tagesausflug tajalliya Tantra tantrisch Tao Tarif tasawwuf
Tasmanisches Meer Tasmanische See Tasmanmeer Tasmansee Tasten Tat Tauchen Eldon
Taylor Team team building Teamentwicklung Teamfähigkeit Teamgefühl Teamgeist
team spirit Teamwork Technik Technologie Teilhard de Jardin Teilzeit-Ausbildung
Telefon Tellaro Teneriffa Terminvereinbarungen Test Testpsychologie Text
Textkörper Textur Thanatos The Candle And The Flame Thema Themen
Themenzentrierte Interaktion Theorie Theosophie Thermosphäre These Third Eye
Thomas-Evangelium Thomas von Aquin Thronvers Tibetanische Klangschalenmeditation
Tibetan Singing Bowl Meditation

Tic-Störung Tiefenpsychologie Tiere Tierschutz Tierwelt Tipps Titel Tod Todd J

Sheridan Todestrieb Toleranz Toleranzentwicklung Topographie Topographisches

Modell Tora Torah Toroidal Vortices Tour Tourismus Tourismusforschung

Tourismuspsychologie Tourismussoziologie Tour Operator Tractatus

Logico-Philosophicus Trailer Training Traktate Trance Trancezustand

Trancereisen Trani Tranquilizer Transaktionsanalyse transformierende
HauptenergiezentrenTranspersonale Psychologie Transport transsituative
Konsistenz Trance Transzendentale Meditation Transzendenz Trauer Traum Trauma
Traumarbeit Traumdeutung Traumreise traurig Tree of Life Tree of Patience
Treffen Treue Trèves Trèvezel Trieb Triebverzicht Trier Trinidad Bay Trinity
Alps Trinity College Trinken Trojaner Tropic of Cancer Tropen tropisch
Tropopause Troposphäre T-Shirt Türkei Tugenden Tunesien Tyrrhenisches Meer Neil
deGrasse Tyson. Übelkeit Über die Wiedergeburt und das Gebot des Schweigens
Überbewusstsein Überdauernde Dispositionen Überdeterminierung Übergänge
Über-Ich überschwenglich Übertragung Überwachungsstaat Überweisung 'Uhane Uhr
Uhrzeit Umbruch Umschwung Aufruf zum Umsturz Umwälzung Umwandlung
Umweltpsychologie Ungeschehen machen wollen Umweltschutz Una Una Finnegan Unbehagen
unbehaglich Ungewissheit Unglaubwürdigkeit Unified Field 'Unihipili unio
mystica unisex Unity Universität Universitätsclub Unruhe Unruhen unsicher
Unsicherheit unsicher-vermeidender Bindungsstil Unterernährung Unterkunft
Unternehmung Unterwasserwelt Unterwerfung versus Kontrolle Untersuchungseinheit
unwandelbare Urbilder und Muster unzufrieden Unzufriedenheit Upanishaden Urlaub
Urlaubertypologie Urlaubsflirt Urlaubsmotive Urlaubsziele USA Insel Usedom
Ustica. Validität Variable Varianz Variation Brian Vaszily Vatikan Veda
Vedangas Vedanta Veden Vega Charles Veitch Ventotene Veränderung verärgern
verärgert Veranstaltungen Veranstaltungsbesuch Veranstaltungskalender

Verantwortungsbewusstsein Verarbeitung Verarbeitungsmodus Verbindung

Verbundenheit Vercors verdeckte Aktion verdeckt Ermittlung verdeckte

Selbstinstruktion verdecktes Verhalten Verdrängung Vereinigte Staaten von

Amerika Vereinigung vererbt vererbte Muster Vererbung Vergeben Vergebung

Vergegenständlichung Vergleichende Psychologie Verhalten Verhaltensexperiment

Verhaltensauffälligkeiten Verhaltensgenetik Verhaltenskonsequenz

Verhaltensmodifikation Verhaltensmuster Verhaltensstörungen Verhaltenstherapie

Verhaltensübung Verheißung Verkehr Verkehrsmittel Verkehrspsychologie

Verkehrung ins Gegenteil Verkrampfung Verleugnung Verlust Vermarktung Vermögen

vermutlich Vermutung Vernazza Verpflichtung Vers Verschiebung Verschwörung

Verschwörungstheorien Versicherungen Versorgung Verstand Verstopfung Verteiler

Verteilungsform Verträglichkeit Vertrauen Verwahrlosung Verwandlung Verzeichnis
Verzeihen Verzweiflung Vesuv Vesuvio Vialas Videos Videotelefon Vigilanz
Villalago Viparikakarani Vis Vishishta-AdvaitaVishishtadvaita-Vedanta Vision
Visions of a Sustainable World Visualisierung Vita vita activa vita
contemplativa vital VitalaVia Vitalität Vitalseele Vogelperspektive Völlegefühl
vollkommene und zeitunabhängige Urbilder und Muster Vollzeit-Ausbildung Vom
Denken und Wahrnehmen Vorbehalte Vorbewusstes Vorbilder Vorlesung Vorliebe
Vortex Vortex of Change Campaign Vorurteile Vorwissen Vox Populi - Methods of
Manipulation - by Megan 'Verb' Kargher featuring interviews with David Icke Max
Igan Freeman Jordan Maxwell Dr. George Rhodes Ben Stewart and Charlie Veitch
Vulcano Vulkan Vulkanismus. wach Wachheit Wachstum Wachstumsbedürfnis
Wachstumsorientierung Wachstumsreisen Wachstumsseele Wachstumstendenz
Wanderfisch Wärme Waffenhandel in Deutschland Waffenhandel in Europa
Waffenhandel stoppen Wahn Wahrnehmung Wahrnehmungsfilter Wahrnehmunsstörungen
Sylvester Walch Wales Wandel Wanderfisch Wanderung warm Warning Warnung
Wartezeit Wartezeit-Überbrückung Wasser Wassersport Wattenmeer Alan Watts Wave
Weaverville Webautor Webcam Wechsel Weddellmeer Weddellsee Weg Wege der Seele
Lehre des Weges
道教 weibliche Apostel Wein weise
Weisheit Weiße Rose Weißes Meer Weißlicht Weißmeer Weissagung
Weiterbildungsstudiengang Psychologische Psychotherapie Weiterleitungsadressen
Ernst-Ulrich von Weizsäcker Welle Wellness Welt WeltApp Weltatlas
Welterlebniskarte Weltflugsimulator Weltkarte Weltkulturerbe Weltkulturwunder
Weltnaturerbe Weltnaturwunder Weltoffenheit Weltraum Weltreise
Weltreisesimulator Weltreligionen Weltseele weltweit Wende Wendekreis des
Krebses Wendepunkt Wendung gegen die eigene Person Werbung Werte Wertgefühl
Werthaltung Wertorientierung Werteorientierung Wertesystem Wesen wesentlich
Westfeste Wetter Widerstand Widerstandsfähigkeit Widerstandskraft Wie wirklich
ist die Wirklichkeit? Wiederfinden Wiederfinden-Forum Wiederfinden-Portal
Wiedergeburt Wiedersehen Ken Wilber Willenskraft William James Willigis Jäger
Wintersonnwende Winter Solstice Wirbel Wirkfaktoren Wirklichkeit
Wirklichkeitsebenen Wirksamkeit Wirkung Wirkungsfeld Wirtschaftswachstum Wissen
Wissenschaft wissenschaftlich With One Voice Witze Wohnen Wortfront Wunder
wunderbar Wunsch Wünsche Würgereflex wütend Wut. Xenophobie. Yajurveda
Yerkes-Dodson-Gesetz Yin und Yang Yoga Yoga-Asanas Yogasutra Yogi Bhajan
YouTube Yul Yunus Emre. Zadar Zannone Zauber Zauberer Zauberin Zeichen
Zeigarnik-Effekt Zeit Zeigeist Zeitmessung Zeitraffer Zen Zen-Buddhismus Zensor
zentraler Kulturgedanke Zero Field Energy Zero Point Field Zeugnis Ziel
Zielbewusstsein Ziele Zielerreichungsskalierung Ziggy Marley Zirbeldrüse
Zirkularität Zitate Zittern Zivilcourage Zohar Zoophobie Zoom ZoomApp
Zoomfaktor Zoomwert z-Transformation Zhuangzi Zufall Zufallsexperiment
Zufallsprozess Zufallsvorgang Zufriedenheit Zugehörigkeit Zugehörigkeitsgefühl
Zukunft Zuneigung Zunge Zusammenbruch Zusammengehörigkeit
Zusammengehörigkeitsgefühl Zwangsgedanken Zwangshandlungen Zwangsstörungen
Zwänge zweiseitige Hypothese (ungerichtete Hypothese) 2012 Zweitausendzwölf
zweite Begegnung zweite Chance zweites Ich Zyklothymie Zyklus Zypern.
achtsamkeitsreisen aerodromedarairstrips
aka-demie aka-hunaaktionspotentialeall-adressealpha-adressealphaaugenalphablickalphaflirtalphagehirnwellenalphalächelnalphamarkealphawavebookalphawaveclubalphawaveclub.comaltopianoalumnibundampel-adresseanti-burnout-adresseaufwiederflirtenaugenblick-adresseaugenblickshirtaugenweide-adressea-und-o-adresseaxonhügel.backcountrypilotbe-adressebeflügelndbegegnung2 beratung-luftlinieberge-adressebesteortebesuch-adressebewuss-tbilder-adressebindestrich-adresseblickadresse
blick-adresse blickagentblickagenturblickamtblickauskunftblickbackblickbegegnungblickbookblickcheckblickechoblicken2blickfang-adresseblickforumblick-gpsblickkisteblickkontaktdatenblickkoordinatenblicklandblickmarkeblickmausblickmonitorblicknnaviblickortsmarkeblickpageblickpinblickpinnwandblickprofilblickregisterblickresonanzblickseiteblickseitenblickshirtblicksiblicksignalblicksucheblicktreffenblickvermittlungblickverzeichnisblickvzblickwebblickzentraleblickzugabebookfairlinebuch-adresse.chancen-adressecheck-in-adressecoaching-adresse
coaching-luftlinie coachingplusreisen communi-t
community-adressecontac-tcortexbookcortexclubcortexplanet.deinflussreichdeinreisefuehrerdendritendendritenbaumdeutschland-adresse deutschland-blicke deutschlandbunddeutschland-lächelndeutschlandmarkediese-adressedopaminblickdopapindu-adressedurchblick-adresse.earthappebautoreine-adresseeinheizblickeinheizlookeinheizshirtempfangs-adresseendorphinblickenergie-adresseentspannungs-adresseerholungs-adresseerkenntnisreisenerlebnis-adresseerlebnisatlaserlebnispiners-tersticluberstishirteuphoriepineupineurekapool europa-blicke europa-lächeln europassage europa-traumreiseexis-texperimental-adresseeyecursoreyes-t.facefairlinefacelookxfantasie-adressefantasieflugfavoriten-adressefeierabend-adressefernwehwehchenfernwohlfilmreifreisenfinde-adressefindehinfindepinfinderbuchfliblibookfliblibuchflir-tflirtambulanzflirtamtflirtblickbookflirtblickbuchflirtblickshirtflirtchance-verpasstflirtechoflirten2flirtfairlineflirt-gpsflirtklinikflirt-kontaktaufnahmeflirtkontaktdatenflirt-kontaktdatenflirtkontaktdatenbank
flirtkoordinatenflirtluftlinieflirtmarkeflirtnameflirtnamefinderflirtnamesucheflirtorteflirtortsmarkeflirt-pinflirtpinnwandflirtplacebookflirtpuzzleflirtresonanzflirtrettung flirtsensor flirt-verlorenflirt-wiederfindenflirt-wiedersehenflirtzugabeflow-adressefluss-adresseflusskussforums-adressefoto-adressefoyer-adressefrankreich-traumreisefreigeis-tfreihei-tfreiluft-adressefreizeit-adressefunkenshirtfunkensprung-adresse.gast-adressegedanken-adressegedankenstrich-adresse
genuss-adressegeprickeltgespräch2gesprächs-adressegesundheit-adressegesundheits-adressegipfelluftgoldhasebook goldphasebuch gruppenreisen-adresse.haben-oder-sein-bookhaben-oder-sein-buchhappy-end-adressehasebookheimatvzherzschlag2heuhaufennadelheureka-adressehiddenbeachhiddencanyonhiddenlakehier-adressehinblickehinfindenhinwollenhorizont-adressehumanityshirthumor-adresse.ich-adresse
ichplusreisen ideal-adresseideen-adresseikoordinatenimpuls-adressein-aller-munde-adresse
iyouwebook. jeckbook jetzt-adresse.kennenlern-adresseklickshirtknistershirtkoffeinblickkontaktaufnahme-verpasst
kontaktpuzzlekontakt-verpasstkraft-adressekroatien-traumreisekuckbookkult-adressekunst-adresse.lächelblicklächelfllirtlächellandlächelshirtl-adresselaternen-adresselebens-adresselebensfreude-adresselebensstil-adresselebenswert-adresse lebenswertreisenlichtseiten-adresselieblingsortsmarkeliteratur-adresselockbooklogie-adresselogin-adresselogo-adresselookfairlinelookilooklookplacebookluftlinie-adresse.mars-adressematrix17matrix-adressematrixcontactmeer-adressemeerestrips
meerseeland mensch-adressemerk-adressemesapienzamesapinmesavolametaphasebookmetaphernabcmetaphernreisemountaintopairportmusenkuss-adressemusik-adresse.
nana-i-ke-kumu naturschönheiten-adressenavigationssternnavigavianavilavia neckbook neologistisch
neuorientierungsreisen neuronennetzwerkniveau-adresse orientierungsreisen ortepforteortideeortschatulleortzauberortzeitflirtortzeitname ostlichtraum
ponopono portal-adresse psychologen-luftlinie
psychologentipps psychologie-adressepsychologiemetaphern psychologieplusreisen psychologie-positive
psychologie-reisen psychologisch-reisen
psychotherapeutisch-reisen psychotherapie-reisen
reisegefühlreisegoldschmiedereisehinsiderreisekoordinatenreiseleitertipps reiselösungen reise-mit-gefühl reise-mit-liebe reise-mit-menschen
reisen-adressereisenähkästchenreiseniveau reisephilosophie reisepin
reisepoesie reise-psychologe
reise-psychologie reisepsychologie reise-psychotherapeut
reise-psychotherapie reise-selbsterfahrung reisesimulator
reisesinn reise-therapeut reise-therapierelax-adresseruhe-adresse.sahneorteschatz-adresseschönheit-adresseschriftsteller-adresse
selbstbegegnungsreisen selbst-begegnungs-reisen
selbstentdeckungsreisen selbstplusreisen seminar-adressesensor-adresseserotopinshirt-adresseshirtkontaktshirtmarkesingletraumreisensinn-adresse sinnfindungsreisensonnenseiten-adressespaziergang-adressespiegelsextantsprachbildergaleriestart-adressestimulus-adressestrand-adressestreichelwortstudibund
südlichtraum sympathie2sympathie-adressesynapsenspaltsynergiewirkung.tagespintagorttext-adressetextballoon therapeutisch-reisen topoesietopoetrytopopintoposiatopplacebooktop-secret-adressetraum-adressetraumkoordinatentraumreiseberatertraumreiseleitertraumreiseperlentraumreiseplanertraumreisepsychologetraumreiseroutenplaner
wachstumsreisenwanderfishwaswaswaswe-adresse webcampsy weckbook wege-adressewegebookwegweiser-adresseweiterleitungszielwelche-adressewelcome-adressewelluminatiwelt-adresseweltapp welt-blicke weltenmarke
welt-lächeln weltnaturwunderweltorteweltpinweltreisesimulatorweltweitwoweltweitwunderwelt-weit-wunsch-adresse
westlichtraumwe-t-shirt weyoubook wiederblicken
wiederfinden-forumwiederfindenportalwiederfinden-seitewiederflirtenwiederseh-adressewiedersehen-forumwiedersehen-portalwiedersehen-seitewiedersehensportalwillhinwillkommen-adressewir-adressewirkungsfeldwirkungsfeld-adressewir-shirtwolke-sieben-adressewonnesonnewoortework-life-balance-adresse youseeland youtopoyouwebook youwebooking youwecam youwecom
youwelook youwetube youweweb.zauberblickshirtzaubermarkezauberortsmarkezauberpinzauberpinnwandzauberplacebookzeit-adresseziel-adressezoomappzoomayazoombuchzoomflugzoomwert zufriedenreisen

Druckversion Druckversion | Sitemap Diese Seite weiterempfehlen Diese Seite weiterempfehlen
© OzeanClub / Freizeitclub.NRW Düsseldorf